SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003718 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003718
Domain Number 1 Region: 175-515
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.47e-46
Family Pancreatic carboxypeptidases 0.0000151
Further Details:      
 
Domain Number 2 Region: 2-156
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.91e-45
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00015
Further Details:      
 
Domain Number 3 Region: 514-608
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 7.26e-21
Family Carboxypeptidase regulatory domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003718   Gene: ENSTGUG00000003566   Transcript: ENSTGUT00000003759
Sequence length 702
Comment pep:known_by_projection chromosome:taeGut3.2.4:22:144917:148202:-1 gene:ENSTGUG00000003566 transcript:ENSTGUT00000003759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPIGLESHRIEDDQILASSMLRHGLGAQRGRLNMQAGTNEDDFFDGAWCAEDDSRAHWLE
VDTRRVTMFTGVITQGRDSQIHDDFVTSFYVGFSNDSQHWVMYSNGYEEMMFYGNVDKDT
PVLSEFPEPMVARYIRIYPQRWNGSLCLRLEVLGCPLSAVSSYYTQQNEVTSTDNLDFRH
HSYKDMRQLMKVVNEECPTITRIYNIGKSSRGLKIYAMEVSDNPGEHETGEPEFRYTAGL
HGNEALGRELLLLLMQFLCKEYQDGNPRVRGLVTDTRIHLVPSLNPDGYELAHEATGQWG
GMWRGLWDSGTVGWGGKAVGCSPPSELTSALDWLQGSQAGHPRCLDKGMGPGAVGTWVVG
CTPWITSAPGNHGRGGEKLVSFPFDTARPSPPTPAAAPRPPDYEDERPELQETPDHAVFR
WLAISYASAHLTMAETFRGGCHAQDVTDAMGIVQGAKWRPRAGSMNDFSYLHTNCLELSV
YLGCDKFPHESELQQEWENNKESLLTFMEQIHRGIKGVVTDQQGEPIANATIVVGGINHN
VRTASGGDYWRILNPGEYRVSARAEGYNPSVKTCHVLYDIGATQCNFVLSRSNWKRIREI
MAMNGNRPIRRVVPGRPMTPRERLRLRMRLRHRMRLREQMRLRRLNATAATGSPTAPPPS
TALPFPFSSTAYTPWSQEPPTAGTWEMDTETEVVTELVTETE
Download sequence
Identical sequences H0YZI4
59729.ENSTGUP00000003718 ENSTGUP00000003718 ENSTGUP00000003718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]