SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003721 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003721
Domain Number 1 Region: 572-663
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.44e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.00075
Further Details:      
 
Domain Number 2 Region: 58-227
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.3e-35
Family G proteins 0.00000206
Further Details:      
 
Domain Number 3 Region: 332-394,512-557
Classification Level Classification E-value
Superfamily PH domain-like 2.06e-17
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003721   Gene: ENSTGUG00000003583   Transcript: ENSTGUT00000003762
Sequence length 665
Comment pep:novel chromosome:taeGut3.2.4:7:2408013:2681518:1 gene:ENSTGUG00000003583 transcript:ENSTGUT00000003762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAIRAEIQRFESVHPNIYSIYELLERVEEPVLQNQIREHVIAIEDAFVNSQEWTLSRSVP
ELKVGIVGNLASGKSALVHRYLTGTYVQEESPEGGRFKKEIVVDGQSYLLLIRDEGGPPE
AQFAMWVDAVIFVFSLEDEVSFQTVYHYYSRMASYRNTSEIPMVLVGTQDAISSTNPRVI
DDARARKLSNDLKRCTYYETCATYGLNVERVFHDVAQKIVSTKKKQQLSIGPCKSLPNSP
SHSSVCSAQVSATSNGGGSLSDYSSSVPSTPSTSQKELRIDVPPTANTPTPVRKQSKRRS
NLFTSRKGSDPDKEKKVLESRTDSIGSGRAIPIKQGMLLKRSGKSLNKEWKKKYVTLCDN
GVLTYHPSLHDYMQNVHGKEIDLLRTTVKVPGKRPPRATSACAPISSPKTNGLSKDMSSL
HISPNSEAVHASSGPSPPQEALAGPSQPSGTQLMSSNTGLGDSVCSSPSISSTTSPKLDP
PPSPHANRKKHRRKKSTSNFKADGISGTAEEENFEFIIVSLTGQTWHFEATTYEERDAWV
QAIESQILASLQSCESSKNKSRLTSQNEAMALQSIRNIRGNSHCVDCEAQNPDWASLNLG
ALICIECSGIHRNLGTHLSRVRSLDLDDWPIELIKVMSAIGNELANSVWEENSQGHVKPS
SDSTR
Download sequence
Identical sequences H0YZI7
59729.ENSTGUP00000003721 ENSTGUP00000003721 ENSTGUP00000003721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]