SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003723 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003723
Domain Number 1 Region: 31-93
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000459
Family Complement control module/SCR domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003723   Gene: ENSTGUG00000003618   Transcript: ENSTGUT00000003764
Sequence length 190
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:226538:354522:1 gene:ENSTGUG00000003618 transcript:ENSTGUT00000003764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMPAASTAGLDGLRSSALGRDSGGPRGYTGQCSRLLSPQFGSLQVLHGNGTDVGTVVTFQ
CPAEHQLEGPGIVTCVWKGNSTQWTAGVPSCKPISKYETFGFKVAVIASIVSCVVILLMS
MAFLTCCLIKCAKKSDRRRTQREMQLWYQLRTEELEHMQAACFGFKGRNNNNIRGAFQVP
HCAGQSWCSC
Download sequence
Identical sequences H0YZI9
59729.ENSTGUP00000003723 ENSTGUP00000003723 ENSTGUP00000003723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]