SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003750 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003750
Domain Number 1 Region: 302-519
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.23e-24
Family Laminin G-like module 0.065
Further Details:      
 
Domain Number 2 Region: 111-218
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000771
Family Cadherin 0.0057
Further Details:      
 
Domain Number 3 Region: 3-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000257
Family Cadherin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003750   Gene: ENSTGUG00000003610   Transcript: ENSTGUT00000003792
Sequence length 846
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:5030356:5049515:1 gene:ENSTGUG00000003610 transcript:ENSTGUT00000003792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NKHKPWIETTYHGIVTENDNTVLLDPPLIALDKDAPLRFAGEICGFKIHGQNVPFEAVVV
DKSTGEGIIRSKEKLDCELQKDYTFTIQAYDCGKGPDGANAKKSHKATVHIQVNDVNEYA
PVFKEKSYKATVIEGKRYDNILKVEAVDADCSPQFSQICSYEIVTPDVPFAIDKDGYIKN
TEKLSYGKEHQYKLTVTAYDCGKKRAAEDVLVKISIKPTCKPGWQGWSKRIEYEPGTGSL
ALFPGMHLETCDEPITSVEATVELETNHIGKGCDRDTYSEKSIHRLCGAASGTAELLPPP
SSAANWTVGLPTDNGHDSDQVFEFNGTQAVKIPDGVVTVNLKEPFMISVWMRHGPGTKEK
ETILCNSDKTDMNRHHYTLYVHNCRLVFLLRQDPSEGKSYKPAEFHWKLNQVCDKEWHHY
VVNVEFPAVSLYVDGVSYDPFPVTEDYPLHPSKIETQLVVGACWQVFSSVEACPADSSAE
QHSSGELRMAQFFRGSLAGLMIRSGKLENKKVIDCLYTCKEGLDLQMADGVGKGVKLHMN
PSQSTLTIEGDDIDRVDKAMQHISYLNSRQFPTPGIRRLKITSTVKCFNEEACVSIPSVE
GYVMVLQPEEPKISLSGINHFARSASEFESSEGVSLFPELRIISTITREVEPEGDGDEDP
TVQESLVSEEIMHNLDMCEVTVLGEELNQEQESLEIDMTRLQQKGIEMSSSNLGMIITGV
DTMANYEEVLHLIRYRNWHTASLFDRKFKLLCSELNGRYVSNEFQVEVNVIHTASPVEHA
NHIAAQPQFIHPVHHSFVDLSGHNLANPHPFSVVPSTATVVIVVCVSFLVFMIILGVFRI
RAAHQR
Download sequence
Identical sequences H0YZL6
ENSTGUP00000003750 ENSTGUP00000003750 59729.ENSTGUP00000003750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]