SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003761 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003761
Domain Number 1 Region: 606-670,708-807
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-32
Family Pleckstrin-homology domain (PH domain) 0.0057
Further Details:      
 
Domain Number 2 Region: 1224-1357
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-20
Family Second domain of FERM 0.0054
Further Details:      
 
Domain Number 3 Region: 819-933
Classification Level Classification E-value
Superfamily PH domain-like 9.31e-18
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003761
Domain Number - Region: 1126-1205
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000272
Family First domain of FERM 0.074
Further Details:      
 
Domain Number - Region: 31-120,713-733
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00188
Family FCH domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003761   Gene: ENSTGUG00000003612   Transcript: ENSTGUT00000003803
Sequence length 1499
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:16425219:16471280:1 gene:ENSTGUG00000003612 transcript:ENSTGUT00000003803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELSEPEGTVNWKERCLTLESQLMKFRLQASKIRELLAEKMQQLEKQVIDADRQAERAF
QQVQIMEEKLKAANVQTSESETRLYKRCQDLEILIQDKNDIIQKLEQQLEEQKQIRLQEA
KIIEEKAAKIKEWVTVKLHELEVENQNLRLINQKQTKEMKTVQSKLQEATGKKSVTSTQK
PGECQRLSSLTFGCFSNRARSPQPSPKLEEISKASSKESNYPEGKNMPEKDILETTFAGP
VHETNKGQKSLQQSSSGSEQNKNVRTSCSSKDIDSDMSKNSCTTGSDWSSDEDGGDNKGL
KSRCASTLSSHTSEENTRYSRVGSEMYLTASDDSSSLFEEESFDVKRTQQKKPYSWQQGS
QRKGLSNLSGKCNSDFTRKKKHQDSSSDELNKKFQSQRLDYSSSSSEANTPSPILTPSLT
PKHPILATSAASQCATPSDFPSNLPHPKLRTPNVFSLNSGLAKKHLSQPQLSSDRMFGRN
RNAISMIRPWRPQETDIDLVDGEDADILEKMEIGCDEGVFTYDTTEAQNAEAQELCDTTK
KGATNKPPTPPLHRFPSWESRIYAVAKSGLRMSEAFTVESLNKNAVSLTSCSISGLYTSL
IYKNMTTPVYTTLKGKATQISNSPFLDESSGSEEEDSSRSSSRTSESDSRSRSGPGSPRA
MKRGASLSSVTSESDYAIPPDAYSVDTDYSEPEQKLPKTSSSSSDNGKNEPLEKSGYLLK
MGGKVKTWKRRWFVLKGGELLYYKSPSDVIRKPQGQIELNASSHIERGDGKQTIQLTTEK
RTYYLTADSPNILEEWIKVLQNVLKIQAASPLFVQSEIKPTMKGLLTKVKHGYSKRVWCA
LVGKILYYFRNQEDKFPLGQIKLFEAKVEEVDRSCDSDEDYEASGRSLLSTHYTVVIHPK
DQGPTYLLIGSKHEKDTWLYHLTVAAGSTSVNVGSEFEQLLCKLLNVEGDATSQIWRHPT
LCHSKEGITSPLTTLPSEALQTEAIKLFKTCQLFINAAVDSPAIDYHVSLAQSALQICLT
HPELQNEICCQLIKQTRRRHPQNQAGPIQGLQLLALCVGLFLPQHPFLWLLKLHLKKNAD
SRTEFGKYAIYCQRCVERTQRNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIY
QVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFSDDPSGKDIEHCLQGNIKICDIISK
WEQASKEQHPGKCEGTRTVRLTYKNRLYFSVQVHGETDREKLLLVYQTNDQIVNGLFPVN
KELAMELTALLAQAEIGDFERPFSTPAGQVNSQSKSNQTLKQVLERFYPKRYKQGCSEEQ
LRQLCQRLSTRWMALRGHSAADCVRIYLTVARKWPFFGAKLFAAKPLATASVEESFIWFA
VHEDGISILDYSSMRLTVTYTYKSLMTFGGYQDDFMLVVNNAQTKDKSTEKHLFAMTKPK
ILEITLLIASYINNFHQLKGVAHHLSAPALLAPQVDRNSRMGSQPLLAINRPTKCPTLL
Download sequence
Identical sequences H0YZM7
ENSTGUP00000003761 59729.ENSTGUP00000003761 ENSTGUP00000003761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]