SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003771 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003771
Domain Number 1 Region: 497-554
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000212
Family UBA domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1-55
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000391
Family Ubiquitin-related 0.00057
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003771
Domain Number - Region: 176-226
Classification Level Classification E-value
Superfamily ARM repeat 0.0027
Family Mo25 protein 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003771   Gene: ENSTGUG00000003644   Transcript: ENSTGUT00000003813
Sequence length 558
Comment pep:known_by_projection chromosome:taeGut3.2.4:25:230242:238879:-1 gene:ENSTGUG00000003644 transcript:ENSTGUT00000003813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFKEEISRRFKAKQDQLVLIFAGKILKDGDTLNQHGIKDGLTVHLVIKTPQKVQDSTSAA
SPPNAASAPTATPSSPAAPSQPSTSSSAGPDGSGSRRSSGPGTVGGPGDGGPNSAASILS
GFGGIAGLGNLGMGSANFMELQQQMQRQLMSNPEMLSQIMENPLVQNMMSNPDLMRQMIM
ANPQMQQLMERNPEISHMLNNPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYN
ALRRMYTDIQEPMFSAAREQFGSNPFSSLTGNSDSSSSQPLRTENREPLPNPWSPTPPAS
QSQAPSSEGSTGSATTQGTPTVSNPFGLNAASMGTGMFNSPEMQGLLQQISENPQLMQNM
ISAPYMRSMMQTLAQNPDFAAQIMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPDSLSIL
TNPRAMQALLQIQQGLQTLQTEAPGLVPSLGSFGMPRMPPSSTGGSTIPENPVPSASTPA
SASPTGGGNPQQQLMQQMIQLLAGGSSQAQSPEVRFQQQLEQLNAMGFINREANLQALIA
TGGDINAAIERLLGSQPS
Download sequence
Identical sequences H0YZN7
ENSTGUP00000003771 ENSTGUP00000003771 59729.ENSTGUP00000003771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]