SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003788 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003788
Domain Number 1 Region: 299-666
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.17e-105
Family beta-glycanases 0.000000612
Further Details:      
 
Domain Number 2 Region: 1-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-51
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.00038
Further Details:      
 
Domain Number 3 Region: 190-300
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.00000000000158
Family beta-Galactosidase/glucuronidase domain 0.0063
Further Details:      
 
Domain Number 4 Region: 668-771
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000111
Family beta-Galactosidase/glucuronidase domain 0.017
Further Details:      
 
Domain Number 5 Region: 775-853
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000023
Family beta-Galactosidase/glucuronidase domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003788   Gene: ENSTGUG00000003629   Transcript: ENSTGUT00000003830
Sequence length 855
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:21465560:21511614:-1 gene:ENSTGUG00000003629 transcript:ENSTGUT00000003830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLRGSWRLRSGNGSVALRAEVPGCVHTALLGGLIQDPYYRFNDVMYRWISLDNWTYSRMF
KTPFDIRKWQKVNLVFEGVDTVAQILLNNVTLGRTDNMFNRYSFDITSMIQEVNFVEVRF
LSAVSYAAEQSRCYKAHSIPPACPPPVQKGECHVNFIRKEQCSFSWDWGPSFPTQGIWKD
VRIEAYNHYHLIYFSITPFFAKSAQQWYLEVESIFDVVSSKPIAGLVTVNIPKLQTQQTF
SVKLQPGEGSIVLLVNINKSAAVEAWWPNGHGKQTGYNMTTTFMMKAGCQMEKFSKVYFR
TVELVQEPIPGSPGLSFYFRINGRPIFIKGSNWIPADSFQDRVTYDTLRLLLKSAADANM
NALRVWGGGIYEQDEFYDICDEIGIMIWQDFMFACALYPTDQNYLESVRAEVSHQVRRLK
SHPSIILWSGNNENEAAIASNWFSIPYSDIGVYVKDYVMLYVKNIRKIVLSEDKSRPFVT
SSPTNGLESVKEGWLSQNPYDTHYGDTHFYDYNSDCWNWTVYPKTRFASEYGFQSWPSFS
TVEKVSSPEDWSYTSNFSLHRQHHEGGNIQMLQEIGRHFKLPQSSDPVKQFKDMIYLTQV
MQAQCIKTETEFYRFSQSEIINGEGHTMGALYWQLNDIWQAPSWASLEYGGKWKLLHYFA
QNFFAPLLPVAYEDKGMLNIYGVSDLHEDHKLTLRVVVHAWSSLEPVCTLAKEGVTVKAQ
SAVPIYKESISDLLERCRNCTRRSCVITFCLVGGDGLRSPTNHYFLSSLKDAVGLEKTQL
RASVSQQDDIYVFVLQTTAIAPFVTLDVGSIKGRFSDNGFLMTEKKKMVVFYPWEPTSAE
ELKSSLILTSLLDVV
Download sequence
Identical sequences H0YZQ4
ENSTGUP00000003788 59729.ENSTGUP00000003788 ENSTGUP00000003788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]