SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003792 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003792
Domain Number 1 Region: 4776-4991
Classification Level Classification E-value
Superfamily GFP-like 1.15e-60
Family Domain G2 of nidogen-1 0.00084
Further Details:      
 
Domain Number 2 Region: 3981-4077
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-25
Family I set domains 0.0072
Further Details:      
 
Domain Number 3 Region: 2868-2967
Classification Level Classification E-value
Superfamily Immunoglobulin 6.63e-25
Family I set domains 0.0078
Further Details:      
 
Domain Number 4 Region: 1083-1178
Classification Level Classification E-value
Superfamily Immunoglobulin 1.54e-24
Family I set domains 0.0099
Further Details:      
 
Domain Number 5 Region: 2284-2385
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-24
Family I set domains 0.0085
Further Details:      
 
Domain Number 6 Region: 3150-3251
Classification Level Classification E-value
Superfamily Immunoglobulin 6.85e-24
Family I set domains 0.0048
Further Details:      
 
Domain Number 7 Region: 2378-2477
Classification Level Classification E-value
Superfamily Immunoglobulin 2.43e-23
Family I set domains 0.023
Further Details:      
 
Domain Number 8 Region: 515-611
Classification Level Classification E-value
Superfamily Immunoglobulin 4.59e-23
Family I set domains 0.016
Further Details:      
 
Domain Number 9 Region: 3524-3623
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-23
Family I set domains 0.017
Further Details:      
 
Domain Number 10 Region: 2487-2573
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 11 Region: 1000-1091
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 12 Region: 4073-4169
Classification Level Classification E-value
Superfamily Immunoglobulin 2.9e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 13 Region: 3892-3987
Classification Level Classification E-value
Superfamily Immunoglobulin 3.24e-22
Family I set domains 0.019
Further Details:      
 
Domain Number 14 Region: 1657-1741
Classification Level Classification E-value
Superfamily Immunoglobulin 4.04e-22
Family I set domains 0.006
Further Details:      
 
Domain Number 15 Region: 4336-4433
Classification Level Classification E-value
Superfamily Immunoglobulin 4.59e-22
Family I set domains 0.0078
Further Details:      
 
Domain Number 16 Region: 1271-1369
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 17 Region: 4268-4352
Classification Level Classification E-value
Superfamily Immunoglobulin 1.62e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 18 Region: 2006-2101
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-21
Family I set domains 0.0099
Further Details:      
 
Domain Number 19 Region: 3617-3712
Classification Level Classification E-value
Superfamily Immunoglobulin 1.84e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 20 Region: 3244-3344
Classification Level Classification E-value
Superfamily Immunoglobulin 3.65e-21
Family I set domains 0.0081
Further Details:      
 
Domain Number 21 Region: 1362-1462
Classification Level Classification E-value
Superfamily Immunoglobulin 4.19e-21
Family I set domains 0.0093
Further Details:      
 
Domain Number 22 Region: 2567-2674
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-21
Family I set domains 0.014
Further Details:      
 
Domain Number 23 Region: 2789-2875
Classification Level Classification E-value
Superfamily Immunoglobulin 4.92e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 24 Region: 2695-2780
Classification Level Classification E-value
Superfamily Immunoglobulin 5.39e-21
Family I set domains 0.013
Further Details:      
 
Domain Number 25 Region: 1734-1833
Classification Level Classification E-value
Superfamily Immunoglobulin 6.19e-21
Family I set domains 0.0056
Further Details:      
 
Domain Number 26 Region: 3706-3805
Classification Level Classification E-value
Superfamily Immunoglobulin 9.09e-21
Family I set domains 0.016
Further Details:      
 
Domain Number 27 Region: 3433-3528
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-20
Family I set domains 0.061
Further Details:      
 
Domain Number 28 Region: 703-798
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-20
Family I set domains 0.0095
Further Details:      
 
Domain Number 29 Region: 2978-3062
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-20
Family I set domains 0.0096
Further Details:      
 
Domain Number 30 Region: 4156-4254
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 31 Region: 3341-3437
Classification Level Classification E-value
Superfamily Immunoglobulin 3.12e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 32 Region: 2190-2290
Classification Level Classification E-value
Superfamily Immunoglobulin 3.35e-20
Family I set domains 0.015
Further Details:      
 
Domain Number 33 Region: 3055-3156
Classification Level Classification E-value
Superfamily Immunoglobulin 4.02e-20
Family I set domains 0.0041
Further Details:      
 
Domain Number 34 Region: 1548-1645
Classification Level Classification E-value
Superfamily Immunoglobulin 6.32e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 35 Region: 3814-3900
Classification Level Classification E-value
Superfamily Immunoglobulin 6.74e-20
Family I set domains 0.021
Further Details:      
 
Domain Number 36 Region: 808-895
Classification Level Classification E-value
Superfamily Immunoglobulin 9.98e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 37 Region: 2095-2196
Classification Level Classification E-value
Superfamily Immunoglobulin 2.07e-19
Family I set domains 0.0066
Further Details:      
 
Domain Number 38 Region: 1458-1555
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-19
Family I set domains 0.0062
Further Details:      
 
Domain Number 39 Region: 430-526
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-18
Family I set domains 0.048
Further Details:      
 
Domain Number 40 Region: 613-710
Classification Level Classification E-value
Superfamily Immunoglobulin 5.52e-18
Family I set domains 0.019
Further Details:      
 
Domain Number 41 Region: 1191-1275
Classification Level Classification E-value
Superfamily Immunoglobulin 7.13e-18
Family I set domains 0.0032
Further Details:      
 
Domain Number 42 Region: 893-986
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-17
Family I set domains 0.0098
Further Details:      
 
Domain Number 43 Region: 4997-5142
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.12e-17
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 44 Region: 1830-1915
Classification Level Classification E-value
Superfamily Immunoglobulin 3.47e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 45 Region: 4603-4660
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.79e-16
Family TSP-1 type 1 repeat 0.0002
Further Details:      
 
Domain Number 46 Region: 4488-4546
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000654
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 47 Region: 4545-4603
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000102
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 48 Region: 4717-4774
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000262
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 49 Region: 6-128
Classification Level Classification E-value
Superfamily vWA-like 0.0000000000000778
Family Integrin A (or I) domain 0.022
Further Details:      
 
Domain Number 50 Region: 5319-5433
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000001
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 51 Region: 4659-4717
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000798
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 52 Region: 4433-4489
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000017
Family TSP-1 type 1 repeat 0.00045
Further Details:      
 
Domain Number 53 Region: 5143-5260
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000385
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 54 Region: 359-433
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000222
Family I set domains 0.049
Further Details:      
 
Domain Number 55 Region: 1965-2011
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000113
Family I set domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003792   Gene: ENSTGUG00000003617   Transcript: ENSTGUT00000003834
Sequence length 5541
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:2241877:2382093:-1 gene:ENSTGUG00000003617 transcript:ENSTGUT00000003834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIGPVTITTDPKKFQFELRELYVQGGGDCPEMSIGAIKIALEISLPGSFIYVFTDARSKD
YRLTHEVLQLIQQKQSQVVFVLTGDCDDRDHIGYKVYEEIASTSSGQVFHLDKKQVNEVL
KWVEEAVQASKVHLLSTDHLSMAVNTWQIPFDPSLKEVTVSLSGPSPAMEIHNPLGKQLS
KGSGLNELLNIHNSAKVVNVKDPEPGTWTIKTSSSGRHSVRITGLSTIDFRAGFSRKPTL
DFKKTSSRPVQGIPTFMLLNTTGILLPARVDRLELLSITGELLKTLPVKYYPDRKPYGLW
NISDFIPPDEAFFVKITGYDKDGYLFQRVSSVLFSSIIPDAPKVTMPMKTPGYYLQPGSV
PCHVDSLIPFTQRFTKNGVKLGVDQFFKESSSMSWDIAQVSVSDEGFYECVASSTAGTGR
AQTFLDVSEPPPVLQVPANVSVVPGAGAVLSCLVLSAGQYNLTWQRHGRDARLQDPLRLR
VLANLSLEVRPAQPSDTGSYSCTAANEGGSATAAVFLTVQEPPRLVISPKNQTFTEGSEV
SIRCSATGYPKPMVVWTLNDMFIIGSSRYRMTPEGTLIIRKAIPRDAGIYGCLASNSAGT
EKQTSTLTYIEGPALTVVQSEILVGVGDTTVMECKTTGIPPPQVKWFKGDLELMASAFLV
IDIHRGLLKIQETQDLDAGDYTCVATNEAGRAAGKITLDVGSPPVFMQEPGDESADLGSN
VTLPCYVQGYPEPRVTWRRLDGAPLFSRPFGLSSSSQLRTGALAIQNLWVSDEGAYVCEA
ENQFGRIQSRPATVTVTGLVTPLIGASPATANVIEGQQLTLPCVLLAGNPIPDRRWIKNN
VVLVPSPYVSVRSDGSLHLERVRLQDGGDYTCMASSVAGTSNSTTTVHVFVVPVIQHGQQ
IFSTIEGIPVTLPCKASGVPKPSIVWSKKGEVILPSNVRFSAGSDGSLYVVSPGGEESGE
YVCTATNAAGYATRKVQLTVYVKPRVSRPGDQQGNAYDKPIEVSVIAGEDVTLPCEVRSL
PPPIITWAKEMQLISPFSPRHTFLPSGSMKISETQVSDSGMYICVATNIAGNVTQSVKLS
VHVPPRIQHGPRVVKVQAGQRVELPCSAQGIPAPSVSWFRGTSAVPTDGGKFLQSPDGAL
GISSAQLSDAGIYTCVATNSAGSDTAEVTIQVQEPPTIEDLDPPFNSPFQERVANQHISF
PCPAKGIPKPAIKWLRNGRELTGAEPGLSVLEDGTLLVIAALTPSDSGDYVCVAANEAGS
TQRRYSLKVHVPPEIRDQDKVTNTSVVVHHPVNLFCEVTGNPFPVISWYKDDIQVVESSA
LQILHNGKILKLLKATTEDAGQYSCKAINIAGSSEKLFNLHILVPPSIIGADSPGEVAVI
LNQEIRLECRAKGFPVPDIHWFKDGKPLFLGDPNVELLDRDQVLHIKSARRVDKGRYQCS
ATNTAGKQVKEVRLIVHVPPSIKGGNMTTEVSVLLNNLINLECEAKGIPVPTITWYKDGQ
RVISSPQALYVDRGQFLQIPRAQVSDSAQYSCRVSSAAGAAEKLFHVDVYVPPVIEGDGD
TAQSRQVVAGNSLTLECKAAGNPPPLLTWLKDGVPVKASDKLHVLAGGKQLEILNAVEAD
QGQYWCVATSIAGEQEIKYDVEILGPFVEGADELLGYIVILHSPLELDCSARGIPSPTIT
WFKDGQPVREEAGHKILLNGQKLVISQAQVSDSGRYKCVATNKAGEHEKEFDVTVHVPPT
IKSAGPSERAVVLHKPVTLQCIASGIPSPSITWLKDGQPVNTARGNIRVKCHSPVLACSR
ALPGDAARYTCVATNAAGEAQQHTRLHVHEPPSLEDAGKILNETVVVNSPIHLECRASGN
PLPAVSWSKDGRALADRGRVLHIEGAQVADSGLYRCLAANAAGTAELLYSLQVHGEIPGI
PRDWHEVRVLLFARRWLEAVAKQVSHCEMSPGSSPWLCAVLPLQVLSGGRVLALPSAQLS
DTGTYTCVAVNAAGESQRDVDLRVYVPPDIVGEEQNVSVLLGQALELRCQGSAVPPPRLA
WLRDGRPLLEKPGLSISADGSVLRIEGAQVQDTGRYTCEATNVAGKTEKNYNVNIWVSPS
ISGSDDSSQLTVTEGSLISLICESSGIPPPSLTWKKNGSPVVPEPSGRVRVLSGGRQLQV
AVADRSDAASYTCIASNVAGSATKEYSLQVYTRPTISNSGPHPSEVIVTQGSEISLECEA
RGIPEPAVMWLKDGRALGSGRDVAVLAGGRVLRLERAQVSDTGHYVCVATNAAGLADRKY
DLSVHVPPSIGGYLQLPENISTVEKNPISLVCEASGIPLPTITWLKNGLPITLNSSVRIL
SGGRTLRLSPVGVADEGHYTCVVTNAAGEARKDFYLSVLVPPGIVGENALEDVKVKEKHG
VTLTCEVTGNPMPQVRWLKDGQALAEAGDPRILSSGQSLQISEAQLLDTGRYTCLASNAA
GDRSKTYSLNVLVAPSIVGADSQGNAEDITVILNSPTSLVCEAYSYPPATITWLKDGNPL
ESSRNIRILPGGRTLQILNAQQDSAGRYTCIATNEAGETLRHYEVKVYIPPTIAKGDVSG
TGLSPKEVKIKVNHSLTLECEAHAIPAAAISWYKDGQARPLQADEHVLIQGSGHTLHIKE
AQVSDTGRYTCLASNIAGEDELEFDVNIQVPPSFQKSYREWEAGNMVDAQRGGESKDVLV
NNPLSLYCETNAVPPPVLTWFKDGHPLSSSDRVLILPGGRALQIARARAGDAGRYACVAV
NEAGQDSIHYHVRVLSPPSISGADGDLREEVTVLVSKEAAMDCIPSGSPSPRITWQKDGQ
LLAEDDKHTFLSNGRRLQILNSQITDTGRYVCIAENIAGSAKKYFNLNVHVPPSVVGTNP
ENLTVVVNNFISLTCEVTGFPPPELSWLKNGKPISSNSNTFIVPGARTLQIPRAKLTDGG
EYTCTARNQAGESQKKSFLTVLVPPSIKAQGGASVTALNVRVGTVVTLDCESNAIPAPVI
TWYKNGRLIPDSAAVEVLADGQTLRIKAAEVSDTGQYVCKAINIAGRDDKNFHLNVYVPP
SIEGPGQELVSESISNPVTFVCDATGIPPPTLVWLKNGKPIENLDSLEVHILSGGSKLQI
ARSQLLDSGTYMCIASNPEGKAHKTYVLSIQVPPSIAGSEMPSEVSVLLGESAQLLCNAT
GVPTPDVQWLKDGKALSQRSTKQTHLTPDGSTLNISRALTSDTGKYTCVATNPAGEEDRI
FNLNVYVPPTIANSKDEAEELTALLDTSLNIECAAAGTPPPQLHWLKNGLPLSVSSQIKL
LSAGQILRLSRVQISDAGVYTCVASNRAGVHNKHYNLQILVPPSLDNAGTEEVLVLRGDA
ASLGCVSDGSPVPEVSWLKDGLALPPGAQLSSSRRGMVLQVLRAVPADAGTYTCVASNAA
GQSSKHFVLRVLEPPHINGSDEPEELSVIVNNPLELLCISSGIPVPKISWMKDGRPLLPT
DNIHMLREALRITSAQVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGTGGPQELTVL
QNSQAILECRSDAVPPPTISWLKNGELLQGGPRLRILSSGRYLQINNAELGDSARYTCVA
RNVAGETTREFLLAVHVAPTIRSSPQTATVHINASALLECAAEGVPAPRITWRKDGAVFT
GNNSRYLVLEDGSLHIPWAQVADTGRYVCMATNAAGSERQRIDLHVLVPPAIAPGQTNIT
VTVNVQTTLPCEATGIPRPAISWKKNGHLLSVDQNQNTYRLLSSGSLVIISPTVDDTAVY
ECSVSNDAGEDQRAIDLTVQVPPSIADEATELLVTKLSPVVVSCTASGVPIPSVHWTKNG
IKLLPRGDGYRILSSGAVEIPSAQLAHGGRYTCVARNAAGSAHRHVTLYVQEPPVIQAQP
GTLDVIVNNPVVLPCEAMGTPQPMIMWQKEGINIITTGNSYMVQPSGSLQIARAAVEDAG
TYMCVAQNPAGTALGKIKLKVQVPPVIKSHVEEYVVAVDQSVTLQCEAEGYPGPQISWHK
DGQQITESMRRRILSTGALQILFVQPGDSGRYTCTAANPAGSSTSSTELAVHVPPRIRST
DTQYTVTESSQALLSCVAEGIPAPTINWRKDNMLLGDTVGKYQTVPGGDLILDNVVPEDS
GSYTCIATNAAGEDTHTVTLTVHVLPAFTELPGDVALTKGEQLRLTCKATGVPVPRITWT
FNNNIIPAQYDDVNGHSELLIERVSKEDSGTYVCSAENTVGSIKAIGFVYVKEPPVFKGD
YHSSRIEPLGGNAMLNCEVRGDPPPTIQWSRKGVGVQISNRIRQLVNGSLAIYGTVNEDA
GDYKCVATNDVGVVERSLTLTLQSPPVITVEPVGTVLEAGATAVLDCQAGGEPPPTISWS
RQGQPVLGDDRVTLLPNGSLRIAPLHREDTAEYECVARNLLGSVLVTVPLTVQVHGGFSS
WLEWRACSVTCGQGVQERVRQCDSPVPANGGRGCQGPHTDLRSCHRQPCPVDGNWSEWGL
WEECSRSCGQGNRTRSRTCSNPPAQLGGKPCEGSTLESVMCNLRPCPVAGEWSPWGPWGP
CSTTCGKGTQTRPRLCTSPAPAHGGPRCQGPDTQLQLCYRRRCPVDGKWSPWSSWSACSV
SCGGGSRQRTRHCSDPAPQFGGHKCEGSDIQMDFCNSDPCPVHGNWGPWSSWGTCSRTCN
GGQTRRYRSCDNPRPASGGRACAGADVQIQRCSTDLCPVDGSWGQWQSWSQCSASCGGGE
QSRVRLCSSPAPLNRGRPCPGDSSQISRCNTQACPGGPARAKGSIIGNINDVEFGIAFLN
ATVTDSPDSDTRVIQAKITNIPRTLGPAMRKLVSILSPVYWTTAKEIGEAMNGFTLTDAI
FKRETQVEFATGEILRMTHVARGLDTDGTLLLDVVVSGHVLQLQSVADVSVKDYTEDYIQ
TGPGQLHAHSTRLFAADGVSVPYTWNHTITYDSSKGRMPFLVQTLRAASIATEYNPLEEA
VAFQIQASIAKGDRSNQCPAGFALDSSGPYCSDEDECAVGNPCSHTCHNAVGSYYCSCPK
GFTISADGRTCQDIDECALGGHSCHAGQDCENLPGSFRCVLRCGSGFRRTPDGLGCQDIN
ECQESNSCHQRCFNTIGSFHCGCDPGFQLKGRKCMDVNECRQNVCRPDQLCKNTRGGYKC
IDLCPSGMTKAENGTCIDVDECRSGSHQCRYNQLCENTRGSYRCVCPRGFRAQGAARPCV
DINECEQVPKPCALHCTNTPGSFKCFCLPGQQLLGDGKSCAGLERVPNSGAYYSSYNYAQ
FSPGRDNQQLQHYYRHSSNLYSSFSEYRNSRIPFSRTRRNLRETCPEGYEARNARCVDID
ECESRDTCQHECRNSLGSFQCVCPAGYRLMPNGKTCQDIDECLEENINCGSNQMCFNMRG
SYQCIDTPCPPNYQREPHSGFCLKSCPANDLECDLSTYALEYKLLSLPFGIAAGQDLIRL
VAYTHDQVMHPRTTFLMADEDAAVPFALRDENWKGVVFTTRALREPRTYRMGVRALSYSA
DGSVEYRTTFIIYIAVSAFPY
Download sequence
Identical sequences H0YZQ8
59729.ENSTGUP00000003792 ENSTGUP00000003792 ENSTGUP00000003792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]