SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003815 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003815
Domain Number 1 Region: 556-910
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.77e-89
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000271
Further Details:      
 
Domain Number 2 Region: 370-552
Classification Level Classification E-value
Superfamily ARM repeat 2.53e-56
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0000269
Further Details:      
 
Domain Number 3 Region: 204-353
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.62e-47
Family PLC-like (P variant) 0.0013
Further Details:      
 
Domain Number 4 Region: 1-162
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-38
Family Ras-binding domain, RBD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003815   Gene: ENSTGUG00000003652   Transcript: ENSTGUT00000003857
Sequence length 921
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:5053041:5070397:-1 gene:ENSTGUG00000003652 transcript:ENSTGUT00000003857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLHEFDSVQDPEVSDFRTKMCQFCEEKAAKRQQLSWAAWMEYNFPLQLEPVAKGLGVGSL
QIPTKNIFVNIKFQSGGESFTFQISPWEFPITLMSYAIKKQATVFRHETVQKPEDYTLQV
NGKCEYLYGNYPLYQFQHIRSCLQRGRTPHLTMVHSSAIIAMRDEQTNGITSPPKAAPKP
PPLPKKKPNYGSLWSLEQPFYIELVQGSKVNADERMKLVVQAGLFHGTEMLCKTVSSSEV
SVCSEPVWRQRLDFDISVCDLPRMARLCLALYAVVEKAKKARSTKKKSKKADCPIAWVNV
MLFDYKDQLKTGECCLHMWSSFPDEKGELLNPMGTVQCNPNTESAAALVICFPVAAHPVY
YPSFAQLLELGRNGEQPRAAPEDSEELQLREILERRSHTELYEHEKDLVWKMRYDIRDQY
PQALAKLLVITKWNKHEDVAQMISLLQTWPELPVLNALELLDFSFPDRYVGSFAVNSLKK
LTDDDVFQYLLQLVQVLKYESYLDCELTKFLLERALSNRKIGHFLFWHLRSEMHVPAVAL
RFGLILEAYCRGSTHHMKVLMKQGEALNKMKALNDFVKVSSQKATKPQTKEMMHMCMKQE
TYREALSHLQNPLNPNIILAEVCVDQCTFMDSKMKPLWIVFNNEETGGGGVGIIFKNGDD
LRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDKTGLIEVILRSRTVSGCPVPLCR
TSETPGPGAQKSLQVLHHEGSRDALDQAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRE
TGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNNEKFERFRGYCERA
YMILRRHGLLFLHLFALMKAAGLPELSCSKDIQYLKDSLALGKTDEEALKHFRVKFNEAL
RESWKTKVNWLAHNVSKDNRQ
Download sequence
Identical sequences H0YZT0
ENSTGUP00000003815 ENSTGUP00000003815 59729.ENSTGUP00000003815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]