SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003828 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003828
Domain Number 1 Region: 1146-1371
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-37
Family Laminin G-like module 0.0027
Further Details:      
 
Domain Number 2 Region: 501-623
Classification Level Classification E-value
Superfamily Cadherin-like 8.25e-34
Family Cadherin 0.0015
Further Details:      
 
Domain Number 3 Region: 183-295
Classification Level Classification E-value
Superfamily Cadherin-like 1.08e-30
Family Cadherin 0.00088
Further Details:      
 
Domain Number 4 Region: 610-722
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 5 Region: 1394-1592
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-27
Family Laminin G-like module 0.017
Further Details:      
 
Domain Number 6 Region: 290-404
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 75-181
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-26
Family Cadherin 0.00074
Further Details:      
 
Domain Number 8 Region: 710-825
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-24
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 404-505
Classification Level Classification E-value
Superfamily Cadherin-like 1.17e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 10 Region: 15-81
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000034
Family Cadherin 0.012
Further Details:      
 
Domain Number 11 Region: 818-920
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000443
Family Cadherin 0.0097
Further Details:      
 
Domain Number 12 Region: 2246-2445
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000412
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 13 Region: 1086-1125
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family EGF-type module 0.013
Further Details:      
 
Domain Number 14 Region: 1725-1764
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000184
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 15 Region: 1596-1629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003828
Domain Number - Region: 1636-1672
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000132
Family EGF-type module 0.024
Further Details:      
 
Domain Number - Region: 1065-1090
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 1775-1828
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00191
Family Hormone receptor domain 0.0081
Further Details:      
 
Domain Number - Region: 1371-1402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0603
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003828   Gene: ENSTGUG00000003678   Transcript: ENSTGUT00000003870
Sequence length 2745
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:15004924:15176233:-1 gene:ENSTGUG00000003678 transcript:ENSTGUT00000003870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGGEGWLVYSMEVLSDERSNEYFTIDAETGSVVTARSLDRETKDTHVLKVTASDHGSPRR
RSATTYLTVTVSDTNDHEPVFEQPEYRESIRENLEVGYEVLTIRATDGDAPANANMLYRL
LEPGAGDGVFEIDPRSGVVRTRASVDREEVSEYHLVVEANDQGKDPGPRSATAMVHITVE
DENDNYPQFSEKRYLVQVPEDAPVNSQILQVQATDRDRGSNAQVHYSIVSGNLKGQFYIH
SFSGAIDLINPLDYETIREYTLRIKAQDGGRPPLINSSGMVSVQVVDVNDNAPIFVSTPF
QATVLENVPLGYSVLHIQAVDADSGENARLEYKLIEMAPSTGGAPVAGDSGFPFQINNST
GWITVAAELDRETVENYHFGVEARDHGVPVMTSSASVSITVLDVNDNNPTFTEKVYHLRL
NEDAAVGSSVLTLTAVDRDVNSVVTYQITSGNTRNRFAITSQSGGGLITLALPLDYKQER
QYVLTVTASDGTRFDTVQVFINVTDANTHRPVFQSSHYTVSVSEDKPIGTSIVTISATDE
DTGENARITYILDDNIPQFRIDPDTGTITTLMELDYEDQASYTLAITAHDNGIPQKSDTT
YVEILILDANDNAPRFLRDRYQGSVFEDVPLSTSVLQLSATDRDSGLNGRLLYTFQGGDD
GDGDFYIEPTSGVIRTLRKLDRENVAVYSLRAFAVDRGSPPLKASVDIQVTVLDINDNPP
VFEKDEFDIFVEENSPVGSIVARISAADPDEGTNAQIMYQIVEGNIPEVFQLDLLNGDLT
ALMDLDYESRTEYVIVVQATSAPLVSRATVHIRLLDQNDNPPVLQDFQILFNNYVTNKSN
SFPSGVIGKIPAHDPDVSDSLAYTFVQGNELNLLLLDSVTGELKLSRDLDNNRPLEALMK
VSVSDGVHSVTAVCTLRVTIITDDMLTNSITVRLENMSQERFLSPLLSLFVEGVATVLST
AKDGIFVFNIQNDTDVTSNILNVTFSALLPGGIRNKFFPSEDLQEQIYLNRTLLTMISTQ
RVLPFDDNICLREPCENYMKCVSVLKFDSSAPFISSNTVLFRPIHPINGLRCRCPPGFTG
DYCETEIDLCYSNPCGSNGLCRSREGGYTCECYEDYTGESCEVNARSGRCAPGVCKNGGT
CVNLLIGGFKCECPPGEYERPYCEMTTRSFPPQSFITFKGLRQRFHFTVSLMFATRERNA
LLLYNGRFNEKHDFIALEIIEEQIQLTFSAGETTTTVAPFIVGGVSDGQWHSVQVQYYNK
PNIGRLGIPHGPSGEKVAVVTVDDCDTAVAVRFGSLIGNYTCAAQGTQTGSKKSLDLTGP
LLGGVPNLPEDFPVHNRQFIGCMRNLSIDSKPIDMAGFIANNGTLPGCAAQRNYCETNWC
QNGGTCINKWSTYICECPVRYGGKNCEQAMPSPQRFSGESIIIWSDLDITISVPWYIGLM
FRTRKVNGMLMQANAGAASKINIQILNSYVQFEVYSGLSQVASLKMSQSRVSDGEWHHIL
VELKSAKDGKDLKYLAVMSLDYGMYQSTVQIGNQLPGLKMKSIIVGGVSGDQVSVQQGFY
GCMQGVRMGETSTNIATLNMKQAIKINVREGCEVDNPCDSNPCPQHSYCSDDWDSYSCVC
DPGYFGRDCVDVCNLNPCEHVSTCVHKPSSSHGYTCECGQSYYGQYCESKIDLPCPRGWW
GNPICGPCNCETSKGFDSDCNKTNGECHCKANYYRPQSSDTCYPCDCFPSGSHTRACDME
TGQCPCKPGVIGRQCNRCDNPFAEVTVRGCEVIYNGCPKAFEAGIWWPQTKFGQPAAVPC
PKGSVGNAVRHCNIEKGWLPPELFNCTTNTFVDLKIMNEKLHHNETKLDGDKTIRIVRAL
QNATQYTHNLYGNDVRTAYQIMIRVLQYESQQQGFDLAATRDVEFNENIIKVGSALLDRS
NKEHWEQIQRTEGGTAHLLRHYEEYFNNVAQNMKKTYMRPFVIVATNMIIAVDIFDKSNF
TGARIPRFHEIKEDYPKDLESSVVFPDTLFRPSERKAVPTMKPSNQKTPSKLNGDVFSPE
SAFAKRKKRHPDIETHHTVAMVIIYRSLGQLLPENYDPDRRSLRLPNRPIINTPVVSTAI
HSDGEFPPNLVEKPVIVEYAMLETEERTKPVCVFWNHSIMIGGTGAWSSRGCELFSRNHS
HIACQCNHITSSAVLMDISKREVGDVRLMIFGDFGFQGLWLRSLVIHFTLKNQNLSQYEQ
LYLNSEKIKGSIFKSNSNFPALSLLQFVCTVIAILLHYFYMSTFAWMFVEQLHIYRMLTE
VRNINFGHMRFYYVVGWGIPAIITGLAVGLDPQGYGNPDFCWLSVHDTLIWSFAGPIVMV
VIINTVIFILAMKASCRRRQRSFEKTGVISVLRTAFLLLLLISATWLLGLMAVNSDVMTF
HYLFAIFSCLQGLFIFFFHCVFNKEVRKHLKNTLTGKKPLPDDSTATRATLLTRSLNCNN
TYIEEPNMYRTTMGESTVSLESTVRDEAAHKLSGSSSQVRAGQTEADSSIFHRNPSKSNE
HDSDSDSELSLDEHSSSYASSHSSDSEEDGLETEKKWNTSTSKNNEHGPLHSTPKVDTLP
NHVKPYWPTECVTASDGEDPGRKQKLKVETKVNVELHRENQVNHSNEAPQDKENEGQQKE
NRPLAHQNNQQPEQRKGILKNKVTYPPPLVDKNMKNRLREKLSDYNQSTVSSRTTSLGTN
EGVRSPSDSGVTVKNVRREQSRDQLNGMAMTLHVGTGHADTSDSE
Download sequence
Identical sequences H0YZU3
ENSTGUP00000003828 59729.ENSTGUP00000003828 ENSTGUP00000003828

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]