SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003906 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003906
Domain Number 1 Region: 857-966
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000847
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 963-1090
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 652-762
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000989
Family Growth factor receptor domain 0.023
Further Details:      
 
Domain Number 4 Region: 574-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 5 Region: 746-886
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000251
Family Growth factor receptor domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000003906
Domain Number - Region: 100-148
Classification Level Classification E-value
Superfamily FnI-like domain 0.00146
Family VWC domain 0.022
Further Details:      
 
Domain Number - Region: 415-521,573-616
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00251
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003906   Gene: ENSTGUG00000003758   Transcript: ENSTGUT00000003948
Sequence length 1201
Comment pep:novel chromosome:taeGut3.2.4:12:964787:1029199:-1 gene:ENSTGUG00000003758 transcript:ENSTGUT00000003948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCTGAECQALENCIEDVLEPGECCATCLQHGCTCEGYQYYDCVNVGFVNGKVPEGQSYFV
DFGSTECSCPKGGGKISCQFMLCPELPPNCIDAVVPADGCPQCGRIGCLHEGQKYVAGHT
FHMPPCKVCHCPNAGGELMCYQLPDCDTPGDAEDGEPERHYDDPYSYDQEASEQHPGGVS
KEVQELLVPPGAREPQPGAGDYDYLAASVAPSVPAPADPHTEATAAPGTTPAPRDPAEAR
GTTERGERRRLPRTTAPSLQQVTRKEAPATTRAPPQHTTATTETPQRLEELERKPKGSKE
RNEQERAPHSKMKKHARKEEPENSMYPGLKEVNFTEPSSERSSHERLEGNDFPKVKFSAT
TSPPVALNEDGSQSSPKQSQTLYRYHPEEDGDPNSIHANPRLPEGSTKELIESCCGAGQQ
WAIDNGECTEIPVSGMDGDICRVAQQQCCVSALRESSCLAGMVAAKEGDACGPEDSDPCA
GSSYKQCCDCCSLGLRLRSEGRSCESNINLGYPCSHVLLSCCEGGDHFVHPELKRHPEPV
PTVTPKKVSEREEHHEALSISSEAELSNNLPGDDLDECLLYGGELCQHLCINTVGSYKCS
CFPEFTLQEDGTSCSPDSHYPDRGQMTRLEAEATIPPVASPSQPILVEEQDKCKDNGPCK
HLCNIVEGDAVCSCMAGYTLMADGVSCEDLDECLTGAQACSSGQLCENTLGSFSCVSHSG
MCAEGFILNRHRKCVDINECVTERHTCQRREHCVNTMGSFRCLQELSCQPGHELKDGECV
DIDECERGTHSCKVNFVCQNTEGSFYCESKQRCMDGFLQDPEGNCVDINECTSLPEPCKP
GFNCINTVGSYTCQRNMLSCSRGYHSNEEGTRCVDVDECQTGVHRCGEGQLCHNLPGGYR
CDCKMGYQYDSFSRSCIDINECWNYPGRLCQHTCENTPGSYHCTCSSGFRLSYDGKHCED
VNECDNSPCSQECANVYGSYQCYCRQGFQLAEDGHSCKDIDECTQSAGILCTFRCVNVPG
SYQCACPEQGYTMAANGRTCRDIDECAIGTHNCSAAETCYNIQGSFRCLSFECPSNYRKV
SDMRCERISCFNYLECQNTPVRITYYQLNFQTNIVVPAHIFRIGPSPAYAGDNIVLTITK
GNEEGFFSTRRLNSYTGIVYLQRQVKEPKDFLLDVEMKLWRQGTYTTFLAKIYIFITAHA
Y
Download sequence
Identical sequences H0Z021
59729.ENSTGUP00000003906 ENSTGUP00000003906 ENSTGUP00000003906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]