SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003940 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003940
Domain Number 1 Region: 1-229
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-61
Family Eukaryotic proteases 0.0000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003940   Gene: ENSTGUG00000003827   Transcript: ENSTGUT00000003982
Sequence length 235
Comment pep:novel chromosome:taeGut3.2.4:1A:18014673:18016772:-1 gene:ENSTGUG00000003827 transcript:ENSTGUT00000003982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WPGEVSVQATLENGTCHMCSGALILPQWVLTVAQCFFGAGDISRWEVVMGHGSEPAGPEA
EVRHIQSLMVHQYYDPATARNNMALLELERPVECSDYIQLGCVPDSSLAVPELRTCYIAG
WRAAPDSAPGPRPLLQEAKVRLMDAQVCNSSCWYGGAVQPQELCAWYPRGGIDTCQGDIG
GPLVCKDKNRDHFWLVGLASWGKGCAGAKRPGVFTSTQHFHTWILVQMGLLQPEA
Download sequence
Identical sequences H0Z055
ENSTGUP00000003940 59729.ENSTGUP00000003940 ENSTGUP00000003940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]