SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003982 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003982
Domain Number 1 Region: 395-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.91e-23
Family MAM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 21-157
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 3 Region: 128-232
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000235
Family Growth factor receptor domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003982   Gene: ENSTGUG00000003842   Transcript: ENSTGUT00000004026
Sequence length 541
Comment pep:novel chromosome:taeGut3.2.4:4:22565528:22610887:1 gene:ENSTGUG00000003842 transcript:ENSTGUT00000004026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWPRHMVSSAGLCRFGSRIDCCWGWARVAWGQCQPICQPGCKHGECIGPNKCKCHPGYTG
KTCNQDLNECGLKPRPCKHRCMNTYGSYKCYCLNGYMLMPDGTCSNALSCLMANCQYGCD
VLKGEVRCRCPSPGLQLGPDGRTCVDIDECATGRVLCPRFRHCVNTFGSYICRCHKGFDL
MYIGGKYQCHDIDECSLGHHQCGSFSHCYNTPGSYKCICKEGYRDNGTNCILIPIVLIEP
RGPYHIFKALSLREAVGRMSRIVDAEDTTPQTHVPGFVTERPVTRPTVHPTTGLTALVKP
PPPTTPQPTTVRPTLAPQRTPLVTTEEPSRVPIETTSSQGVIDDNRIQPDPQKPRGDVFI
PRQPGVSNNLFEILEIERGITADEFEANDDPGVLVHSCDFDSGLCGWIKDKDDDLHWEPV
RDVSGGQYLTISDPKGKEGGVAHLILPLGYLAQAGDLCLSFRHKVPGLHSGTLQVFVRKT
GAHGPAVWGRNGGHGWRQTHITLRGVGIKSVIFRGEKGKGRTGDIGLDDVVLRRGRCSEE
H
Download sequence
Identical sequences H0Z095
59729.ENSTGUP00000003982 ENSTGUP00000003982 ENSTGUP00000003982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]