SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000003983 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000003983
Domain Number 1 Region: 15-265
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.23e-80
Family Carbonic anhydrase 0.00000102
Further Details:      
 
Domain Number 2 Region: 312-503
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.05e-30
Family Pentraxin (pentaxin) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000003983   Gene: ENSTGUG00000003847   Transcript: ENSTGUT00000004027
Sequence length 507
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:5276732:5478524:-1 gene:ENSTGUG00000003847 transcript:ENSTGUT00000004027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LISCSHRLSLSVGEGELDEEHWGQHFPDCAGQQQSPIDIQRRKVRYNPLLQLELGGYEGP
LQGQLRMTNNGHSVQIDLPPTMNISRGLPGVYTAVQMHLHWGGLDLESSGSEHTIDGMRY
FAELHIVHYDSANYSSFEEAKDKPQGLAVLAFLYTDGHFENTYYSEFISKLARIRFAGQS
TTLSSLDIQAMLPENLSHFYRYQGSLTTPPCSESVIWTIFHSPIVLSHTQVQLLENTLLD
WHNRTLRNDYRHAQPLRGRVVEASFRAPRGQAQCHPEEFTLRLDQIQMQLQDMKTELLNG
LSHTGTKSSTFPAFYFPVENIESFVEVHPLRAVSLQAFTLCFWSRAQPVGSQTVLSYSTG
ERDRELAVTVGSELGLWVGGHFLSFPLQQEAQGWLHHCVTWASPEGRASLWLNGAAGQAQ
SVQKGYVSRAGGTLLLGKARDALLGTFSNGFGGWLSRVNLWSRVLSAAELRALALCRAGQ
PTGDVIAWGQTPMALLGGVLLQPDTSC
Download sequence
Identical sequences H0Z096
ENSTGUP00000003983 ENSTGUP00000003983 59729.ENSTGUP00000003983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]