SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004018 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004018
Domain Number 1 Region: 20-108
Classification Level Classification E-value
Superfamily UBA-like 1.66e-32
Family UBA domain 0.00000711
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004018   Gene: ENSTGUG00000003834   Transcript: ENSTGUT00000004062
Sequence length 1107
Comment pep:novel chromosome:taeGut3.2.4:25:426470:455971:1 gene:ENSTGUG00000003834 transcript:ENSTGUT00000004062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTSVGTTRARGSWEQTQTQSQTQHKQRPQATAEQIRLAQMISDHNDADFEEKVKQLIDI
TGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKGVSGQKESGQTEPSEES
KENRDRERDFSRRRGGLPRRGRGATRGREFRGQENGLDGAKSGGSSGRGTERGRRGRGRG
RGGSGRRGGRFSAQGMGTFNPADYAEPASTDENYGNSNNTWNNTGSFEPDDGTRLDFIGG
EGSNYPRKFDTAPGAWRAATEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQR
IDLAVLLGKTPSSMENESTNLESSQTPSLAQPLVFSNSKQSALSQPASGNSFSHHSMVSM
LGKGFGDVGEAKGSSTTGSQFLEQFKTAQALAQLAAQHTQPAGSTTAASWDMGSTTQTSS
LVQYDLKNPTDSSVHSPFTKRQGFTSTSTMIEVFMQEKQPVVTASTTTPAPPSSPLPSKT
NPVPQMSPGSSDNQSSSPQPAQQKLKQQKKKASLTSKIPALAVEMPGSSDISGLNLQFGA
LQFGSEPVLAEYESTPTTSAAVSQSQSSLYTSSASESSSTISSNQSQESGYQSGTIQTAT
FTSQNSAQGPLYEQRSTQTRRYPNSISSSPQKDLTQAKNGFSSVQPTPLQTTQAVEGATG
PAVKSDSPSAPSIAPLNDGVSATSLLTTASQHSTALSSLSHSEELPSTTTAQLSSALPTQ
QNSLSSSTSSGRTSTSTLLHTSVESEASLHSSASTFSTSSSTVSAAPPVVSVSSSLSSVS
SLGLSLSSNSTVTASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGY
DDLQMLQTRFPLDYYSIPFPTPTTPLTGRDGSLSSNPYSGDLTKFGRGDASSPAPATTLA
QPQQSQTQTHHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQ
HGVNVSVNASATPFQQPSGYGSHGYSTGVSVTSSNTGVPDISGSVYSKTQQSFEKQGFHT
GTPAASFNLPSALGSGGPINPATAAAYPPTPFMHILTPHQQPHSQILHHHLQQDGQSGSG
QRSQGSSIPQKSQANKSAYNSYSWGAN
Download sequence
Identical sequences H0Z0D1
XP_004174818.1.42559 ENSTGUP00000004018 59729.ENSTGUP00000004018 ENSTGUP00000004018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]