SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004123 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004123
Domain Number 1 Region: 301-562
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.08e-65
Family Protein kinases, catalytic subunit 0.00000000437
Further Details:      
 
Domain Number 2 Region: 1-70
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.92e-21
Family Ras-binding domain, RBD 0.0000552
Further Details:      
 
Domain Number 3 Region: 70-123
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000124
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004123   Gene: ENSTGUG00000004006   Transcript: ENSTGUT00000004168
Sequence length 579
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:1820655:1841060:1 gene:ENSTGUG00000004006 transcript:ENSTGUT00000004168 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRVFLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLLAEPKGPFWNTDAASL
IGEELRVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVP
TMCVDWSNIRQLFFFSAWNCVYIAFGQVALNSVFHLPEGKKLTTTLPLSLFPSQLPARYS
TPHAFTFNPSNPSSEGSLSQRQRSTSTPNVHMVSTTMPVDSRIIERAQGSAGAATASTGA
AAPSAFLSTAHSLPQLADHSESAQRERAPGSNTQEKNKIVSIVVRKFSSMDCRIPQQQVG
QEILGKGSCIFITFVVIVFPGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFM
GYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARPTAQGMDYLHAKNIIHRDM
KSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDSNPFSFQS
DVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCL
KKVREERPLFPQILSSIELLQHSLPKINRSASEPSLHRA
Download sequence
Identical sequences H0Z0N6
59729.ENSTGUP00000004123 ENSTGUP00000004123 ENSTGUP00000004123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]