SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004125 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004125
Domain Number 1 Region: 921-1043
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-26
Family Ankyrin repeat 0.000000241
Further Details:      
 
Domain Number 2 Region: 4-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.96e-23
Family Ras-binding domain, RBD 0.015
Further Details:      
 
Domain Number 3 Region: 1052-1110
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-16
Family SH3-domain 0.0000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004125   Gene: ENSTGUG00000003997   Transcript: ENSTGUT00000004170
Sequence length 1119
Comment pep:known_by_projection chromosome:taeGut3.2.4:3:18150387:18181684:-1 gene:ENSTGUG00000003997 transcript:ENSTGUT00000004170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQMFLTVYLSNNEQHFTEVPVTPETTCRDVVELCKEPGETECHLAEVWCGSERPIADNE
RMLDILQRFGMQRGEVRFFLRHERSPCREAGTGQRSQDPAFKRNGVKVPGDRRIENGVSA
PRMDMTLAELQEMASRQQQQIEAQQQMLANKEQRLKFLKQQDQRQQQQAAEQEKLKRLKE
IAENQEAKLKKVRALKGHVEQKRLSNGKLVEEIEQMNSLFQQKQRELVLAVSKVEELTRQ
LEMLKNGRIDGYHDNQSAVAELDRLYKELQLRNKLNQEQNAKLQQQRECLNKRNLEVAVM
DKRVNELRERLWKKKAALQQKENVPVSSDGNLPQPVASAPSRVAAVGPYIQSSTMPRIAS
RPELLVKPAFSDGTQALQVPDGPLKTQTLPNMRAGNSSVIPNAKPSPSAPDWTSSNTDNH
INQGSALTSGKGIDKVSEGENFLRDREKKVRPFSMFDSVEQSAGLGMLRKNQSSEDLLRE
AQTTNKNVTKVPPPVPTKPKQINLPYFGQASHLQPADTKLDGNLQKLPLAIAAAGNKQKP
QIQQRISVPPAGSSSSQDQILPSSKQESPPAAAVRPFTPQPSKETSLPPFRKPQTVAASS
IYSMYTQQQTPGKNFQQAVQSALTRAQTRGPHFPSVYGKPVMAGAGVQNQLPQTENIYSN
LQGKPGSPEPEMETAASAHENHEPERIPRPLSPTKLLPFLSNPYRNQSDADLEALRKKLK
QCPSCVKSFVQIQGVKGIYIQEIDYVRISMTTEESICITSHPSKQTASAASPESPVEIPN
PYLSTESEKETAASMPETAIAEETESTAAEQSEAALPPVPLDPVPEAVSDSDELTQPKPE
EPNLEAPLPLEVYMEEYPPYPPPPYPSGEPESLGEDSFNMRPPEVTGQFSLPPGKRTNLR
KTGSERIGHGMRVKFNPLALLLDSSLEGEFDLVQRIIYEVEDPSMPNDEGITALHNAVCA
GHTEIVKFLVQFGVNVNAADSDGWTPLHCAASCNNVQVCKFLVESGAAVFAMTYSDMQTA
ADKCEEMEEGYTQCSQFLYGVQEKMGIMNKGVIYGLWDYEAQNDDELSMKEGDCMTILRR
EDEEEIEWWWARLNDKEGYVPRNLLGLYPRIKPRQRSLA
Download sequence
Identical sequences H0Z0N8
ENSTGUP00000004125 ENSTGUP00000004125 59729.ENSTGUP00000004125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]