SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004128 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004128
Domain Number 1 Region: 1-70
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.13e-21
Family Ras-binding domain, RBD 0.0000552
Further Details:      
 
Domain Number 2 Region: 280-381
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000000000163
Family Protein kinases, catalytic subunit 0.0000439
Further Details:      
 
Domain Number 3 Region: 69-123
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000748
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004128   Gene: ENSTGUG00000004006   Transcript: ENSTGUT00000004173
Sequence length 383
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:1820655:1835101:1 gene:ENSTGUG00000004006 transcript:ENSTGUT00000004173 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRVFLPNKQRTVVNVRNGMTLHDCLMKALKVRGLQPECCAVFRLLAEPKGPFWNTDAASL
IGEELRVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVP
TMCVDWSNIRQLFCCCSSDHRDPFRFLGKKLTTTLPLYSTPHAFTFNPSNPSSEGSLSQR
QRSTSTPNVHMVSTTMPVDSRIIERAQGSAGAATASTGAAAPSAFLSTAHSLPQLADHSE
SAQRERAPGSNTQEKNKIVSIVVRKFSSMDCRIPQQQVGQEILGKGSCIFITFVVIVFPG
DVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLY
KHLHVQETKFQMFQLIDIARPTA
Download sequence
Identical sequences H0Z0P1
ENSTGUP00000004128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]