SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004129 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004129
Domain Number 1 Region: 676-727
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000837
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 2 Region: 238-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000142
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 3 Region: 886-936
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000167
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 4 Region: 350-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.0053
Further Details:      
 
Domain Number 5 Region: 399-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 6 Region: 845-883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000223
Family Laminin-type module 0.0021
Further Details:      
 
Domain Number 7 Region: 294-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 934-979
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000198
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004129
Domain Number - Region: 52-130
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00595
Family CBM4/9 0.07
Further Details:      
 
Domain Number - Region: 640-678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00753
Family EGF-type module 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004129   Gene: ENSTGUG00000003985   Transcript: ENSTGUT00000004174
Sequence length 1041
Comment pep:novel chromosome:taeGut3.2.4:8:3185675:3245476:-1 gene:ENSTGUG00000003985 transcript:ENSTGUT00000004174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRCMPEFVNAAFKTVLDTHTCGTPAEEYCVQTGVTGVTQSCHLCDAAQPHLSHGAAFLTD
YNSPADATWWQSRTMLAGVQHPTAVNLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTKE
DGPWVPYQYYSGSCESTYHKINRGFIRTGEDEQQALCTDEFSDISPLTGGNVAFSTLEGR
PSAYNFDNSPVLQEWVTATDIRVTLNRLNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKC
NGHASECVKNELGKLVCNCKHNTFGVDCEKCLPFFNDRPWRRATAESANECLPCDCNGRS
QECYFDPELYRATGHGGHCMACAGNTDGPRCERCRDSFYRLASDQGCLPCSCNPVGSLST
QCDSYGQCSCKPGVMGDKCDRCQPGFHSLSEAGCRPCSCNAAGSTGECNVETGRCACKDN
VEGFHCERCKPGFFHLDSSNPRGCTPCFCFGHSSVCTSAVGYSIYSITSNFEFGEDEWHA
EQRDGSEVLLQWSAETQDISVISDTYFPMYFVAPRKFLGNQVLSYGQNLTFSFRVDRRDT
RLSAEDLVLEGAGLRVSVPLIAQGNSYPSENVQTYTFRLHEAADYPWRPALTAFEFQKLL
HNLTSIKIRGTYSERSAGHLDDVTITSARPGPGVPVAWVESCSCPVGYEGQFCERCTSGY
RRETPGLGPYSPCVPCACNGHSETCDPETGMCNCRDNTAGTHCEKCSDGYYGDATAGTAS
DCQPCPCPGTSSCAIVPRTKEVVCTSCQAGTTGVRCSLPASEALQDLGRAGRLHNFKEKY
DDWQPSCFSADFMLGMAESKVQNTCKFLISDQAHKQLMGVPVGPRRPSAQVFSCLMPPSW
DVRKKGTICNQVTGQCECLSHVTGRDCSACEPGFFNLQSGRGCERCNCHALGSTSGQCDI
RTGQCECQPGVTGQQCDSCESNHFGFGSEGCKPCDCDPEGSRSLQCRENGHCECKEGFVG
SRCNQCEENYFYNRSWPGCQECPACYRLVKDKVAEQRQRLQELENLIANLGTREETVTDE
AFEERLKQAEREVTELLHEAQ
Download sequence
Identical sequences H0Z0P2
ENSTGUP00000004129 ENSTGUP00000004129 59729.ENSTGUP00000004129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]