SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004151 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004151
Domain Number 1 Region: 194-372
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.08e-32
Family APC10-like 0.0021
Further Details:      
 
Domain Number 2 Region: 1810-1871
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000141
Family ZZ domain 0.007
Further Details:      
 
Domain Number 3 Region: 1768-1819
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000459
Family ZZ domain 0.022
Further Details:      
 
Domain Number 4 Region: 78-147
Classification Level Classification E-value
Superfamily EF-hand 0.00000157
Family Calmodulin-like 0.084
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004151
Domain Number - Region: 1089-1181
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000968
Family Spermadhesin, CUB domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004151   Gene: ENSTGUG00000004023   Transcript: ENSTGUT00000004196
Sequence length 1986
Comment pep:novel chromosome:taeGut3.2.4:19:4102244:4143462:1 gene:ENSTGUG00000004023 transcript:ENSTGUT00000004196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTAASHSSEEEEEGAEEGMEGAAGAPQAAPLLPPAEVLLEQARLREATARLREAALPEP
LVSRHHSALVRWLEERLSRGDEAVSLEQFCEVLESVSRLAAGSRGESEEAFAQFDAEGDG
TVDVENMLEALKNSSGANLQGELSHVIRQLQACSLVPGFIDIFSESKERLGLHASMILRF
LHRNRISSTAIPYPVLEYFNNICTMRSSVLKDSLDRLLLKEREYPSDLNGNQESDKLKSV
MKCYTHIETSSNSADIDKMTNGETSSFWQSDGSARSHWIRLKMKPDVVLRHLSIAVAAND
QSYMPQQVTVAVGRNASNLQEVRDVHIPSNITGYVTLLENANISQMYVQINIKRCLSDGC
DTRIHGLRAVGYQRVKKVGVSVCDASAIWYWSLLTSLVTASMETNPAFVHTILRNTQKAL
QHMPPLSLTPGSTEFSSFLSPNVLEEVDSFLIRITSCCTTPEVELTLLAFALARGSVAKV
LSSLCAITDHLDTPYKASSLISSMAAVRQNLLYKYGKPLRLTLQACDVKGKEDKSGPENL
LVEPWTGDGFLTETGKTRASIILSTGTESSFQVTQIRLKVRRGAIGAQCGLVFAYNSASE
KFHAEEHFKRFESYDKWKLREFKQFLKTRSSCSCDDLGDDDPIGWFEVEEEWDEVDVRMQ
QCRVSQYLMIKFLCTRQDSAERLGVQGLSVLGYLRPLRDEPCSTMSCLQCRKTEEDTVCG
TTLLLKTLHFIQQLAQDLVQQKESGLKYKSFLDFTGLDLQLFWNFYNKLHQNPREECIFA
QTLLLQLLQSCFSVLTGDNKTAKPQETPQSKTAGHIEAAEELYRHLCEGAVVDMGDSNFM
PMKMLKEEVKNTLLSGAAVFFPDRQTRRHQLFTMMKNITEQEHKQSVHLAFRSLCTHFSD
QDPGGLLLLPEKGVSANFDISEILSVMDTLLLVAARECEMMMLDVAQQESGTVLSSLFWS
VQGSLLSWCYLQLKGTDNSAKDLAVEILKNYVGQFLSNIRTILQSLLSQYSGKTIVEKIS
SSVFAMATRQLVIFLLDFCTLDIPYCTLLQGFSTLIEPLKSLCSEPHKTDMESWQQEQPV
VLRTWTMESPHNYENNCHEVSVFLCHGATYFEVEFDEKCETERRYDYLEFTDARGAKTRY
DTKVGTEKWPKKVTFKAGPRLQFLFHSDSSNNEWGYKFSVTAYGLPDVAVSWGLDLQLLV
SRLMGRLASRSMALKSLRELGSEADLPPLKVTSVLNSPLWKPVFRHQLCPEALPGARQTS
AKHQDKNEARSSPHDVCRNFLTDFAKSDPAQDFSGQKSELFKGLIQACKKQTPKTDIVAG
PTVDQAVNSTFAALVYLTPDLFEKLQKYVNSGGKVPLSDEFAQVYSLADSIRIWMLEMKQ
KSLMGRGNDAEEKQNTEASEMNPETLAKLCVQKSLLLLNFLPIRAKTKDSASDSLEAQDM
DDPQQYVSDQCQRQGSAVDMDFQAAPSVSSSAGIHPVSKERGQASQSDPKVKQIPDLHQA
EEQEDVSSPPSTPTRKSQLSRGRLRLLSFRSMEEPKPVPTVKEKYPILKNILDFIKDQSL
SHESVLKVLALRKSQGQSIMEVLKTIRQCLDSLGQPHCFHPPCVLFLLELLACQKDFTNY
FGNLEGCGAELHKEIRESYYQLVLFLVNSVKGFSTINDRSLLPALSCVQTALLHLLDMSW
EPSDLSFFVEIQLPHLLMTTSQENISIHDSVICQWSEEDEIADYKQNCEWMDECQDVMFE
TWYEKIAQADPEKQRKMHMFVARYCDLLNVDISCDGCDEIAPWHRYRCLQCNDMDLCKTC
FLGGVKPEGHEDDHEMVNMEYACDHCQGVIIGRRMNCNVCDDFDLCYGCYHAKKYSDSHL
PTHSITVYPMVTIRISDRQRLIQPYVHNYSWLLFAALTLYSADLANGEEVEGEKLDPQVV
SHARVLQHQCIQLIGDCLMKAQHGKGLKNLALLCMLPEDESISENCSVSGSPPTDSAPKS
HPGDRA
Download sequence
Identical sequences H0Z0R4
ENSTGUP00000004151 ENSTGUP00000004151 59729.ENSTGUP00000004151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]