SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004156 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004156
Domain Number 1 Region: 19-69
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000108
Family Ubiquitin-related 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004156   Gene: ENSTGUG00000004034   Transcript: ENSTGUT00000004201
Sequence length 154
Comment pep:novel chromosome:taeGut3.2.4:10:2076289:2078998:1 gene:ENSTGUG00000004034 transcript:ENSTGUT00000004201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLPETELGECPLGGCSISLKQLITSKLQESMPDPELIDLIYCGRKLRDDQTLDFYGIQS
GSTVHVLRKSWPEPDQKPEPVDKVAAVREFRVLHTALHSSPAYRDAVFKMLGNKESLDQI
IVATPGLSSDPVALGVLQDKDLFSVFADPNMLDT
Download sequence
Identical sequences H0Z0R9
ENSTGUP00000004156 59729.ENSTGUP00000004156 ENSTGUP00000004156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]