SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004160 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004160
Domain Number 1 Region: 1-93
Classification Level Classification E-value
Superfamily TIMP-like 3.3e-39
Family The laminin-binding domain of agrin 0.0000027
Further Details:      
 
Domain Number 2 Region: 1281-1412
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-23
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 403-469
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 3.19e-16
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 474-535
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000166
Family Ovomucoid domain III-like 0.0092
Further Details:      
 
Domain Number 5 Region: 627-683
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000333
Family Ovomucoid domain III-like 0.0035
Further Details:      
 
Domain Number 6 Region: 1082-1153
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000127
Family SEA domain 0.0032
Further Details:      
 
Domain Number 7 Region: 347-396
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000208
Family Ovomucoid domain III-like 0.0075
Further Details:      
 
Domain Number 8 Region: 185-251
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000236
Family Ovomucoid domain III-like 0.0057
Further Details:      
 
Domain Number 9 Region: 278-324
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000222
Family Ovomucoid domain III-like 0.006
Further Details:      
 
Domain Number 10 Region: 110-176
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000166
Family Ovomucoid domain III-like 0.0062
Further Details:      
 
Domain Number 11 Region: 725-768
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000893
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 12 Region: 779-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004160
Domain Number - Region: 552-587
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0206
Family Ovomucoid domain III-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004160   Gene: ENSTGUG00000004020   Transcript: ENSTGUT00000004205
Sequence length 1412
Comment pep:known_by_projection chromosome:taeGut3.2.4:21:5803233:5851300:1 gene:ENSTGUG00000004020 transcript:ENSTGUT00000004205 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQVRVWRYLKGKDIVTHEILLDGGNKVVIGGFGDPLICDNQVATGDTRIFFVNPAPQALW
PAHRNELMLNSSLMRITLRNLEEVEHCVEDKPNSYFTQTPPPPRDGDRKVTCSFGSSCVP
SPDGQAAKCVCPSSCGGVAESPVCGIDGRDYRSLCHLQKHACDSHQDLAKHFDRPCAAPD
PCAEVTCSFGSSCVPSPDGQAAKCVCPSSCGGVAESPVCGSDGRDYRSLCHLQKHACDAQ
QDLAKQFDGPCDPCQGVPSEPGRVCRVNPRTRRAELLPRPEDCPPGSGPVCGDDGVTYES
ECAMGRAGAIRGIDIQKVRSGQCQQQDRCKDECRFNAVCLNRRGAARCSCERISCDGAFR
PLCGSDGRTYGSDCQRRRAECLRQAGIAVRHRGPCDLGAPSPCLSVECSFGATCVVKNQA
AVCECQQQCQGRYDPVCGTDQRTYGSPCELHAMACLLQRDIGVRHRGPCERCGKCRFGAI
CEAETGRCVCPTECVPSAQPVCGSDGNTYGSECELHVRACTQQENILVAAQGPCKPCGSS
LCSFGGRCEGGQCLCPRCERQPPAPVCGSDGSEANLPCPLSASSCLAHGVEDVREGKAEQ
ECGSGGSGSGDGGECEQERCRHFGGWWDEDAEDEPCVCDFTCAAVPRAPVCGSDGVTYAN
ECQLKKTRCEKRQELFVTSQGACRALATTPPPLLAVHCSQSVYGCCPDNVTAALGVGAAG
CPSSCQCNPHGSYGGSCEPGSGQCSCKPGVGGLRCDRCEPGFWNFRGIVTDSRSGCTPCG
CDPVGSVRDDCEQMSGLCSCRPGISGMKCSRCPAGSSLGSAGCQPDPSTPRSCQELSCDF
GASCVELNGRAHCECPSPLCPEGNATKVWGHPGGTGTREAPQKNCSCSRGWDILPLSVTR
AVPAPCPEAGPATPGTSPVTPPWSLSPLPGPCHPSLGSVTPLSPLFVTLPVPPSSAVPSS
APQSPATARPMATAPVPAATGQPGSSQPGSGESGSAEGSGDLDMGTSGDQEASGAGSAGD
VPRAPSAQVPPTAAIERATCYNSALGCCSDGRTAAADGDGSNCPATKVFQGVLILEEVEG
QELFYTPEMADPKSELFGETARSIESALDELFRGSEVRRDFRSVRVRDLGQSSAVRVIVE
AHFDPATSYTAADIQGALLKQLRAARRKTILVKKPQQEHIKFMDFDWLPRLVTTTVTTTT
GTTAAPGSARRVPAATAALGQPVGSPGQPVGTAGTAGHPAPRAPPAAAAARCPPRPPGTA
PAPPPCASQPCRNGGTCRDDGGFTCSCPVGTAGTTCKKWCPCPLPAFSGSSYLELPCRAS
DRMSLDLVLLARRPRGLILYNGQRSDGGGDFVSLALHGGHLEFRFDLGKGPALLRSREPV
PLDTWVSVRLERSGRKGVLRVNGGPAVTGESP
Download sequence
Identical sequences H0Z0S3
ENSTGUP00000004160 ENSTGUP00000004160 59729.ENSTGUP00000004160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]