SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004187 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004187
Domain Number 1 Region: 54-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000297
Family Spermadhesin, CUB domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004187   Gene: ENSTGUG00000004054   Transcript: ENSTGUT00000004232
Sequence length 322
Comment pep:known_by_projection chromosome:taeGut3.2.4:Z:56938915:56947642:-1 gene:ENSTGUG00000004054 transcript:ENSTGUT00000004232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSAFQFQCHLVLIFLAASKGETRYLEVRDAGENDPFLLLSEDLKRELSAGQIYRRSLRC
IDMLSIEGQFTFTANQPQLHCATFFIGEPEELITIHYDFVNIDCQGGDFLKVFDGWILKG
EKFPSSLDHPLSTSQRYVDFCESGNIQRSIRSSQNVAMIFFRIQLPGNGFTVTVKKISNL
FPCNVISQTPSGRFTMVIPHQHRNCSFSIIYPVVIKISDLILGHLNGLFLKKPSASCAGV
GDFVELLGGAGLDPSKMFPLADLCHSFHGSAQMKIGCDNTVLRMVSSGKHINRVTFEYHQ
LDLQEAETRKENSIEEFCFPSI
Download sequence
Identical sequences H0Z0V0
XP_002190680.1.42559 59729.ENSTGUP00000004187 ENSTGUP00000004187 ENSTGUP00000004187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]