SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004215 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000004215
Domain Number - Region: 102-129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0184
Family EGF-type module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004215   Gene: ENSTGUG00000004101   Transcript: ENSTGUT00000004260
Sequence length 143
Comment pep:known_by_projection chromosome:taeGut3.2.4:10:2186343:2201036:-1 gene:ENSTGUG00000004101 transcript:ENSTGUT00000004260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASAPGSAGDTSLLGSATVWPLKRYGRFLPPKDGDREGQNTSWKVFESNEESGPLVLTIVE
SGHFFISQGRTVLEGFSLIDSHKWLKIVRKAECLLLRAEAKKECRMFRVQFGGSCREEMQ
EHCCSCVQKLSEYVPVQGAEEQS
Download sequence
Identical sequences H0Z0X8
ENSTGUP00000004215 ENSTGUP00000004215 59729.ENSTGUP00000004215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]