SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004229 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTGUP00000004229
Domain Number - Region: 193-245
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000134
Family Ras-binding domain, RBD 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004229   Gene: ENSTGUG00000004107   Transcript: ENSTGUT00000004274
Sequence length 321
Comment pep:novel chromosome:taeGut3.2.4:22:666637:672780:1 gene:ENSTGUG00000004107 transcript:ENSTGUT00000004274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAVPCGKDKFISRNELLLHLKTYNIYYEGQNLQLRHREEEGELIVEGLLNISWGLRRPIR
LQMQDDHQRIRPPPSSSSWHSGCNLGAHGNTVRKAQKYSQKAPKIHQKAPKIQTESPWDP
RPGTPTHPPVPPGRRERRERGMRRKRRKRRSRRRRRKRGMRRERRITQGCAGSHILTSVF
TPYGSVTNVRINSTMTPQVLKLLLNKFKIENSAEEFALYMVHTSGEKQKLRGSDFPLLAR
VLQGPCEQVSKVFLMEKDQVEEVTYDVAQYIKFEMPILRSFIQKLEEEEDREVKKLKHRY
SILRLMIEQRLEEICEGPTAM
Download sequence
Identical sequences H0Z0Z2
ENSTGUP00000004229 ENSTGUP00000004229 59729.ENSTGUP00000004229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]