SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004230 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004230
Domain Number 1 Region: 112-360
Classification Level Classification E-value
Superfamily vWA-like 2.45e-81
Family Integrin A (or I) domain 0.0000000233
Further Details:      
 
Domain Number 2 Region: 357-445
Classification Level Classification E-value
Superfamily Integrin domains 9.94e-28
Family Integrin domains 0.0000972
Further Details:      
 
Domain Number 3 Region: 612-695
Classification Level Classification E-value
Superfamily Integrin beta tail domain 7.85e-18
Family Integrin beta tail domain 0.00035
Further Details:      
 
Domain Number 4 Region: 5-56
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000035
Family Plexin repeat 0.00093
Further Details:      
 
Domain Number 5 Region: 571-611
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000109
Family Integrin beta EGF-like domains 0.0017
Further Details:      
 
Domain Number 6 Region: 528-566
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Integrin beta EGF-like domains 0.0078
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004230
Domain Number - Region: 497-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family Integrin beta EGF-like domains 0.027
Further Details:      
 
Domain Number - Region: 454-480
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0446
Family Integrin beta EGF-like domains 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004230   Gene: ENSTGUG00000004062   Transcript: ENSTGUT00000004275
Sequence length 778
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:4061747:4116095:1 gene:ENSTGUG00000004062 transcript:ENSTGUT00000004275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEGLNLCTSGSATSCEECLLIHPKCAWCSKEDFSSTKSITSRCDFLQNLIASGCTGAIEN
PSSSISVLRNVPLSSKGSGQSHLDVTQITPQKVALNLRPGDRTSFRVQVRQVEDYPVDLY
YLMDLSLSMNDDLDNIRNLGTKLAEEMRKLTSNFRLGFGSFVDKNISPFSYTAPRYQNNP
CIGYKLFPSCVPSFGFRHLLSLTDKVDRFNEEVQKQKVSRNRDAPEGGFDAILQAAVCKE
KIGWRKEASHLLVFTTDDVPHIALDGKLGGLVQPHDGQCHLNEANEYSASSQLDYPSLAL
LGEKLAENNIHLIFAVTKSHYILYKNLTTLIPGTTVEILHKDSKNIIELIVKAYNSIRSK
VELTVWDSPEDIGLTFTATCQDGLSYPGLRKCGDLKIGDTVSFEVAVEARSCPAEATSHS
FTIKPAGFRDTLEVAVTYSCLCGCTGRAAPASAKCSGNGTYACGLCDCQPGYLGARCECQ
EGAGGELHQALCREAEGKPLCSGRGECSCNQCLCYESEFGNIYGPFCECDDFSCARYKGV
LCSGHGECHCGECKCHTGFIGDNCNCSTEMDSCVSSDGQMCSGRGACVCGKCQCTEPGAF
GETCEKCPTCPGVCSTKRDCIECKLFNSGRLADNQTCQKHCKDEIITTVDVLETDDPNAI
LCAYPVNNCVMKFTYLELPSGKSNLTVLKEPACSSAPSAVTIVLAVIGSVVLIGIILLAL
WKLLVTIHDRREFDRFQSERSRARYEMASNPLYRKPISTHNVEFTFNKLNKSYNGTVD
Download sequence
Identical sequences H0Z0Z3
59729.ENSTGUP00000004230 ENSTGUP00000004230 ENSTGUP00000004230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]