SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004238 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004238
Domain Number 1 Region: 8-48
Classification Level Classification E-value
Superfamily UBA-like 0.000000332
Family TAP-C domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004238   Gene: ENSTGUG00000004120   Transcript: ENSTGUT00000004283
Sequence length 165
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:2642017:2650356:-1 gene:ENSTGUG00000004120 transcript:ENSTGUT00000004283 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGAMDELKHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSAFFQETNIPYSHHHQMM
CTPANTPATPPNFPDALTMFSRLKASESFNSSSPVASMATSPPPPAPPLPQHGAFNPAWP
AASPPGQQQSMWTPAAPAQPAGWPAAVSQQASAEQKANVTMEAER
Download sequence
Identical sequences H0Z100
59729.ENSTGUP00000004238 ENSTGUP00000004238 ENSTGUP00000004238

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]