SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004299 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004299
Domain Number 1 Region: 290-544
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.16e-72
Family Eukaryotic proteases 0.0003
Further Details:      
 
Domain Number 2 Region: 97-168
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000379
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0089
Further Details:      
 
Domain Number 3 Region: 224-269
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 4 Region: 185-222
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000393
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 14-74
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000795
Family Ovomucoid domain III-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004299   Gene: ENSTGUG00000004171   Transcript: ENSTGUT00000004344
Sequence length 554
Comment pep:known_by_projection chromosome:taeGut3.2.4:4:24045533:24058196:-1 gene:ENSTGUG00000004171 transcript:ENSTGUT00000004344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLGNQFTHKSCRKVFCHPWERCVEGKCLCKLPYQCPKNGSAVCSANGKTFRTYCQLKSYE
CQQPKAKFLHKGTCKPEETFSVDLDHGDSSLLRVKPMNHKDDSFVCASEWSMNEANVACR
HLGFELGAEYYQATSSIKESALNSLNCLQISCRGLETSLAECHIEMKSRDRYQVNSTLTS
FSSCCTACSDEEFHCVNKKCISLNKTCDGINDCGDLSDELCCRECRENSFHCRSNICIPN
KSVCNKEIDCLTGEDEAGATCAGFLLKDTQAILKAKPDANIFERKMIKTVLPQVHCGVRN
HTLTRRKRIVGGEIAGKGEFPWQVAIKDTSNEGSTVYCGGVYIGGCWVLTAAHCVRANRV
HLYLVWVGMLNTIAYDKETDTFKLNRVIIHENYNTSTYENDIALLELKGSGSGECSLEEK
SIPACIPWSEYMFKTGDRCKVSGWGLEKGYTKQFILKWGNVNLFNNCSELYPGRFFKKMA
CAGTYDGSTDSCKGDSGGPLVCFDAENVAYVWGIVSWGENCGEAGHPGVYTQVASYYDWI
SHYVTRGLISRYNI
Download sequence
Identical sequences H0Z161
59729.ENSTGUP00000004299 ENSTGUP00000004299 ENSTGUP00000004299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]