SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004304 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004304
Domain Number 1 Region: 24-456
Classification Level Classification E-value
Superfamily Sema domain 4.32e-114
Family Sema domain 0.00011
Further Details:      
 
Domain Number 2 Region: 1299-1428,1605-1791
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.57e-50
Family p120GAP domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 794-888
Classification Level Classification E-value
Superfamily E set domains 5.35e-16
Family Other IPT/TIG domains 0.0066
Further Details:      
 
Domain Number 4 Region: 886-975
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000591
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 5 Region: 459-510
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000645
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 973-1077
Classification Level Classification E-value
Superfamily E set domains 0.00000616
Family E-set domains of sugar-utilizing enzymes 0.088
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004304
Domain Number - Region: 1451-1545
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00162
Family Ubiquitin-related 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004304   Gene: ENSTGUG00000004115   Transcript: ENSTGUT00000004349
Sequence length 1824
Comment pep:known_by_projection chromosome:taeGut3.2.4:1A:19717670:19802562:-1 gene:ENSTGUG00000004115 transcript:ENSTGUT00000004349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALWIWTLTILSCFCITLSRNEELKFFQSATELNHLTVDNDTGIIYLGVVNALYQLTENL
EVIRSVETGPRKDNKKCTPPIDENQCKEAVLTDNYNKLLLLNKVDNTTVVCGSLFKGICA
IRDLQNISKEKYYVDSSGEKSFVASNDENVSTVGLITSLNNDQVLFVGKGNGPNDNGVII
STRQLYARDGKDIFEMYTDSTAVKSAYHSSSTQQFVAVFEDKNYVYFIFNQQEKQSINNR
TLIARLCKDDAHYYSYFEMDLGCKDDDGAYDHCHSAYVSTPGDDKVLLALFSKVNKDDGS
LKSAMCVFSLRQINEKMEKNRNDCYTKKNTSSFYKLFSAENPCELHGLNASKNFPCGSEH
LPYLLGSRNGVIEKAVLQKEGMNLTAVTVAVENGHTVAFLGTSDGKILKVFLSSTATEYS
SLTIERNKPVKKDLVLDQTQENLYVMTTDKVYRLPVQDCHKYSDCEKCAQARDPYCGWCV
REGRCTKKADCGTADKENHWLWSLSGTCVTIISAEPLNMSRRAPAKVELTVSPLPALTES
DKVCCTFGETMHSAQLKEGVIICDPPDIIPPTPKHQVIDHVSVPLQLTFEKNKIFFASHT
YPFYDCEEAMNLIENQPCYSCASNRWNCQWDWKRHICEESSSVQDVIKQNMEEECPQFLN
PDPSIIPMEYQTTVYFEGKHLDYYRGKKFVVGNSQFEFEASVDESEEGKFSFVNKEFSYS
ANETLQLNLSIKTDKVKIDSKLMVTLYNCSYGRNDCSLCLAARPEYKCVWCEEDGKPSKC
VYEKLCHTPPTDACPPPEITRIEPKTGPLSGGILLTIMGSNLGIKAEDVKNITVADKECL
FKEEFYSVSTRIVCQVGPMNELQQGQIEVNINGKLGKSPSDVLFTYQEPHPTQIRPESGP
QAGGTRLTISGINLATGSKKDVQVTVGSQPCNVTEFGDEVICITGRNNKVEHVLVTMHYG
GTRITVPQLFTYRENPTVTKFLPVNSFSSGGRNITVTGTGFELIQTFSLVIYAERPEAGR
MNQKRFYGKVVTRLNETTVVFSSPPILEDPENYNITTVILMDHYKLVVKNESHSFAYVAD
PTFENFTDGIKKQVNKLINAKGSNLNKAMTIDEAQAFVGDEPCNIKTLTETDLYCEPPEV
QPQPKKRQKRDTINNLPEFIVKFGLREWILGRVEYDNRVTDIPLNLILPLVLIPMIVIII
ISIICYRRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEMEDQTNDINEAGIPV
LDYKTYTDRVFFLPSKDGEKDVMITGKLDIPEARRQTVEQALYQFSNLLNSKSFLINFIH
TLENQREFSARAKVYFASLLTVALHGKLEYYTDIMRTLFLELMEQYVVAKNPKLMLRRSE
TVVERMLSNWMSICLYQYLKDNAGEPLYKLFKAIKHQVEKGPVDAVLKKAKYTLNDTGLL
GDDVEYTQLTVNVYVQEGGNDSIPVKVLNCDTISQVKEKIIDQVYRNLPCSQWPKADSVV
LEWRPGSTAQILSDLDLTSQRDGRWKRINTLMHYNVRDGATLILSKMGISQQPEDNQQDV
PGERHALLEDENKVWHLVRPVDEMDEGKSKRGSVKEKERTKAITEIYLTRLLSVKGTLQQ
FVDDFFHSVLNSNHVVPPAVKYFFDFLDEQAEKHDIKDEDTIHIWKTNSLPLRFWVNILK
NPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLLYAKEISNYKKMVED
YYKGIRQMVPVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTNKYYDEIINALEEDPA
AQKMQLAFRLQQIAAALENKVTDL
Download sequence
Identical sequences H0Z166
ENSTGUP00000004304 ENSTGUP00000004304 59729.ENSTGUP00000004304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]