SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004330 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004330
Domain Number 1 Region: 636-717
Classification Level Classification E-value
Superfamily Ubiquitin-like 3e-27
Family DIX domain 0.0000645
Further Details:      
 
Domain Number 2 Region: 2-92
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 2.21e-18
Family Regulator of G-protein signaling, RGS 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004330   Gene: ENSTGUG00000004202   Transcript: ENSTGUT00000004376
Sequence length 717
Comment pep:known_by_projection chromosome:taeGut3.2.4:18:2476833:2498025:-1 gene:ENSTGUG00000004202 transcript:ENSTGUT00000004376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SCNGFRQMDPKDTTLRVAKAIYKRYIENNSIVYKQLKPTKTYIRDSIKKQQIDSIMFDQA
QTEIQTVMEENAYQMFLTSDIYLEYVRSGGENPAYMSSNGLGSLKVVCGYLPTLNEEEEW
SCADFKNKILPSVVGLSSKTLRVTANVRATETIENGYRSFKRNDPVNPYHVNSGYVFAPA
TSANDSEISSDALTDDSMSMTDSSVDGIPPYRIGSKKQLQREMHRSVKANGQVSLPHFPR
THRLPKEMTPVEPAAFAAELISRLEKLKQEQETMDCLEERLQQIKEDEEKEGAELPASLQ
SSRDVANPQHPLSLLPSGSYEEDPQAILDEHLSRVLKTPGCQSPGVGRHSPRARSPDRLP
TGKLPPGTASLAACTLLGKGFITKQTTKHHTKHKEGLQLRLRQGGPRPPPPVGDGRPPPR
GTARPPLRAGPRHAPADATQHPGPAGGSVSPPGRGLQAAEATVMATARTVLFAVGGRACV
LPVQAEGWSQGPSWPSLEDEPLSSNPTLHRHKYYCFHSFDGCNLPVFPLGQAPATYQVGN
WTGYPNLTTHRRLQLRRLYFNNFFLKVVFSLFFFPPLLLPHLPPPHFRCSTSNQQRDRNH
SAAIQGGSSPFCNASLTTEDHKEPKKLPVVHTSQSGELVVTYFFCGEEIPYRRMLKAQSL
TLGHFKEQLSKKGNYRYYFKKASDEFDCGAVFEEVWEDETILPMYEGRILGKVERID
Download sequence
Identical sequences H0Z192
ENSTGUP00000004330 59729.ENSTGUP00000004330 ENSTGUP00000004330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]