SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004341 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004341
Domain Number 1 Region: 1253-1432
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-52
Family DBL homology domain (DH-domain) 0.0000000144
Further Details:      
 
Domain Number 2 Region: 1439-1559
Classification Level Classification E-value
Superfamily PH domain-like 1.47e-34
Family Pleckstrin-homology domain (PH domain) 0.00000204
Further Details:      
 
Domain Number 3 Region: 260-396
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-19
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 4 Region: 1071-1208
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-18
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 5 Region: 824-974
Classification Level Classification E-value
Superfamily Spectrin repeat 7.03e-18
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 482-623
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 7 Region: 1618-1683
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000155
Family SH3-domain 0.0034
Further Details:      
 
Domain Number 8 Region: 17-164
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000017
Family CRAL/TRIO domain 0.014
Further Details:      
 
Domain Number 9 Region: 173-291
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000314
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 10 Region: 628-748
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000111
Family Spectrin repeat 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004341
Domain Number - Region: 401-514
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004341   Gene: ENSTGUG00000004175   Transcript: ENSTGUT00000004387
Sequence length 1695
Comment pep:novel chromosome:taeGut3.2.4:7:4233371:4454211:-1 gene:ENSTGUG00000004175 transcript:ENSTGUT00000004387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCFTGSFRNDGLKAADVLPILKEKVAFVSGGRDKRGGPVLTFPARSNHDRIRQEDLRKLV
TYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFWQKQ
KTNFGSSKFIFETSMVSVEGLAKLVDPSQLTDEFEGSLDYNHDEWIELRVSLEEFFNSAI
HLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVIKAPVEELDREGQRLLQCIRS
SDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQD
AEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMNSMNAYVNINRIMSVATRL
SEAGHYASQQIKQISSQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWCKMC
SDGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLTATA
NYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEA
FLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYKA
ARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKELLEDVCADSVDAVQE
LIKQFQQQQTATLDATLNVIKEGEDLIQQLRHPPGVQQHTESQMDSAVSNNKTPHNSSIS
HIESVLQQLDEAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQMND
FNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASGIELICEKDIDLA
TQVQELLEFLHEKQHELELNADQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNASLV
NASSLSEAEQLQREHEQFQLAIEKTHQSALQVQQKAEVLLQAGHYDADAIRECAEKVALH
WQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGGRDKLGPAAEIDH
VIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPGVASHTRGPEQQVKAILSE
LLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEYYLSTHNSTGESAEET
QELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTTVDKRYRDFSLRM
GKYRYSLEKALGINPEDNKDLELDIIPASLSDREVKLRDANHEVNEEKRKSARKKEFIMA
ELLQTEKAYVRDLHECLETYLWEMTSGVEEIPAGILNKEHIIFGNIQEIYDFHNNIFLKE
LEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSSQLILEHAGTFFDEIQQRHGLANSI
SSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKANDAMHVSMLEGFDE
NLDVQGELILQDSFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSSGHTKYVYKNKLL
TSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASSIETKQEWIKNIREVIQERIIHLK
GALKEPIQLPKTPAKQRNNSRRDGIDDADSQGDGSSQPDTISIASRTSQNTVDSDKLSGG
CELTVVLQDFTAGHSSELSIQVGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSSALC
ISHSRSSVEMDCFFP
Download sequence
Identical sequences H0Z1A3
59729.ENSTGUP00000004341 ENSTGUP00000004341 ENSTGUP00000004341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]