SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004357 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004357
Domain Number 1 Region: 993-1118
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-31
Family Cadherin 0.00057
Further Details:      
 
Domain Number 2 Region: 2400-2516
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 3 Region: 1966-2069
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-28
Family Cadherin 0.00083
Further Details:      
 
Domain Number 4 Region: 1423-1529
Classification Level Classification E-value
Superfamily Cadherin-like 1.2e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 357-464
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-27
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 25-136
Classification Level Classification E-value
Superfamily Cadherin-like 2e-27
Family Cadherin 0.00082
Further Details:      
 
Domain Number 7 Region: 892-1005
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-26
Family Cadherin 0.00086
Further Details:      
 
Domain Number 8 Region: 2299-2404
Classification Level Classification E-value
Superfamily Cadherin-like 4.58e-26
Family Cadherin 0.00071
Further Details:      
 
Domain Number 9 Region: 781-890
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 10 Region: 1531-1647
Classification Level Classification E-value
Superfamily Cadherin-like 7.07e-26
Family Cadherin 0.0014
Further Details:      
 
Domain Number 11 Region: 1309-1431
Classification Level Classification E-value
Superfamily Cadherin-like 1.34e-25
Family Cadherin 0.0019
Further Details:      
 
Domain Number 12 Region: 2502-2628
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-24
Family Cadherin 0.0013
Further Details:      
 
Domain Number 13 Region: 1748-1862
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-23
Family Cadherin 0.0018
Further Details:      
 
Domain Number 14 Region: 562-668
Classification Level Classification E-value
Superfamily Cadherin-like 7.99e-23
Family Cadherin 0.0018
Further Details:      
 
Domain Number 15 Region: 1640-1746
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-22
Family Cadherin 0.001
Further Details:      
 
Domain Number 16 Region: 1099-1221
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-22
Family Cadherin 0.0013
Further Details:      
 
Domain Number 17 Region: 457-566
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-22
Family Cadherin 0.0035
Further Details:      
 
Domain Number 18 Region: 1211-1313
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-20
Family Cadherin 0.0025
Further Details:      
 
Domain Number 19 Region: 1856-1964
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-19
Family Cadherin 0.00047
Further Details:      
 
Domain Number 20 Region: 674-781
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-19
Family Cadherin 0.0021
Further Details:      
 
Domain Number 21 Region: 2189-2297
Classification Level Classification E-value
Superfamily Cadherin-like 1.44e-18
Family Cadherin 0.0019
Further Details:      
 
Domain Number 22 Region: 136-253
Classification Level Classification E-value
Superfamily Cadherin-like 3e-17
Family Cadherin 0.0062
Further Details:      
 
Domain Number 23 Region: 2065-2169
Classification Level Classification E-value
Superfamily Cadherin-like 4e-17
Family Cadherin 0.0014
Further Details:      
 
Domain Number 24 Region: 2742-2859
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000002
Family Cadherin 0.002
Further Details:      
 
Domain Number 25 Region: 2618-2713
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000007
Family Cadherin 0.0011
Further Details:      
 
Domain Number 26 Region: 246-354
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000171
Family Cadherin 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004357   Gene: ENSTGUG00000004184   Transcript: ENSTGUT00000004403
Sequence length 3226
Comment pep:novel chromosome:taeGut3.2.4:6:2220161:2368703:-1 gene:ENSTGUG00000004184 transcript:ENSTGUT00000004403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTKSEFTVEFSVSDSQGVIKGTVNIQVGDVNDNTPQFHNQPYSVRIPENTPVGTPIFIVN
ATDPDQGAGGSVLYSFQPPSSFFAIDSGRGIVTVIRELDYEVTQAYQLQVNATDQDKNKP
LSTLANLAVIITDVQDMDPIFINLPYSTNIYENSPPGTTVRMITAVDQDKGRPRGIGYTI
VSGNTNSIFALDYISGALTLNGPLDRENPFYSAGFVLTVKGTELNDDRTPSNASVTTTFN
ILVIDINDNAPEFNASEYSVAIPELAQVGFALPLFIQVQDKDEGPNSVFEVYLVGNNSNH
FIISPTSIQGKADIRVRVAVPLDFETIPRYEFSLFANESVPDHVGFARVKINLINENDNR
PVFSKVLYNVSLFENTTVGTTVLQVHATDNDVGTYGKVSYFFSDDPDRFSLDKDTGVIIL
TARLDFETTQRYTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKEAYLGALRENEPSV
TQVVRLRASDEDSPPNNQISYSIVQASAFRDYFDITMSEGYGVIIVNHPLDYEQVANGVI
YLTVMAKDAGNPPLNSTVPVTIEVFDENDNPPTFSKPSYVIAVMEDIMAGATVLFLNATD
MDRSREYGQESIIYSLEGSSHFRINARSGEITTTSLLDREAKSEYILIVRAVDGGVGHHQ
KTGIAMVNITLLDINDNYPTWKDEPYFINLVEMTPPNSDVTTVVAVDPDLGENGTVVYSI
RPPNKFYSLNSTTGKIRTSGVLLDRENPNAQEAQLMRRIVVSVTDCGRPPLRATSSATVF
VNLLDLNDNDPTFQNLPFVAEIAEGLPAGSSVFQVVAIDLDEGPNGQVSYRMQVGMPRMD
FLINSTGGLVTSTAVLDRERIPEYFLRVVASDAGTPAKSSTSTLTVKVLDVNDENPTFFP
AVYNVSLPEDVARDFKVVRLNCTDADIGLNAELSYFITGGNQDGKFSVGFRDGVVRTVVS
LDRETVASYTLILEAIDNGPSGNRRTGTATVYVTVLDVNDNRPIFLQSSYEVSVPEDIPA
ASSIVQVKATDADEGINGRVWYRIVKGNEHNHFRINPSTGLVMRGVRHLDREQNSSHVLE
VEAYNTEQGPMRSSVRVIVYVEDVNDEVPVFTQRQYNRLGLRETAGIGTSVAVVRATDRD
TGNGGLVSYKIVSGAEGKFEIDESTGLITTIEYLDYETKTSYLMNVSATDQAPPNNQGFC
SVYVSLLNELDEAVQFSNSSYEAVIMENIPLGSEVLRVQARSIDNLNQITYKFDPNTNPQ
ALSLFKINGITGVITVKGQVDREKGDFYTLTVVADDGGPKIDSTVQVTITVLDENDNSPQ
FDITSDSSVSVAEDSAVGKRVALVLARDPDAGRNGQVTFSLTSGNIGRAFEIRTTNGTYG
EVFVARPLDRELLDHYTLRIQASDGGVPPRRKEHVLRVNILDVNDNPPVIDSPFGYNVSV
SENVGGGTAVAQVRATDRDIGLNSVLSYYITRGNEDLTFRMDRVTGEIATRPSPPDRERQ
SFYSLVVTVEDEGNPSLSATTTVYVTILDENDNAPAFRQQLYEVTLDEGPSTLNASLVTV
QALDQDEGPNGKVAYAITEGNILGTFRIDNATGEIRTVKELDYEISHGRYTLIVTATDQC
PIVSRRLTSTATVLVNLNDINDNCPTFPRPYEGPFDVTEGQPGPRVWTFLAHDGDSGPSG
QVEYSIIAGDPLGEFVISPVEGELRVRKDAELDRENFPFYNLTIAAQDRGVPPLSSTILV
GVRVLDINDNDPVLLNLPMNLTLSENAAVSSFVTRVLARDADQGPNALLTFDITAGNTEN
AFYINSTSGIVYVNRPLDRERVAEYRLTVTVKDNPENIRNARRDFDLLVISIADENDNRP
LFTQGSYQAEVMENSPPGTPVTMLNGPILALDADQGINAVVTYELLKASLDLFVINNKTG
VVSVKPGGVIDREALLDPHLEFTLVARDVGGLNSTASLAVTILDDNDNRPVFQPASITAW
LLENSPPGFSVLQVTATDADSGLNQQLDYRIEGGGQDRFLIDATTGVIRVANITIDREER
DAYRLTVVAVDQGTPALSGTATVSIVIDDINDCRPEFINPIQTVSIPESAPPGTVVAEVT
AIDRDLHPRLEYYLLGIVARDDTDALVPDQQGAFTVDFRTGAVKIKTPLNRELVATYEVT
ISVHDNASEVIDRSVSVPNAKLTVNVLDVNDNTPRFRPFGVTYFTERILEGATQGTTLIS
ISAVDPDKGANGQITYELLNLSPEGYACLEDHSAGKVVANRTVDYEEVQWLNFTVRASDN
GSPRRSAEIPVYLQIVDINDNNPVFSHPSYQKAVFEDVPLGTVILSVTATDADSGQFALI
QYSLGDGEGKFGINPNTGDIYILSALDREKKDHYTLTAVARDNPGDVSSNRRENSVQVLI
TVLDINDVRPQFSKSQFSTSVYENEPAGTSVITMSATDLDEGDNGVVTYSIEGPGAEAFK
INKDSGLVTSRRRLQSYERFNLTVVATDKGHPPLWGTTMLHIEVIDINDNRPVFVRPPNG
TILHIKEEIPLRSNVYEVYATDKDEGLNGVVLYNLLKTGAGNKDWEYFSIDSVSGLIQTA
MRLDREKQAVYNLIIVACDQGQPPYETMQPLQVALDDIDDNEPIFLRPPEDSPQYQALSV
PEHSRPGTVVGNVTGAVDADEGSNAIVYYFIAAGNQESNFQLSREGKLKVLRDLDREKEP
YHSIIVKASSQRNWAPPRGQRAARTQFWDLSEDLTLQEVRIFLDDINDQSPQFTKSEYTA
GVATDAKVGSELIRVLAVDADVGNNSLVLYNILGIRYIKQHSNDSEEVANIFSIGTLDGI
LRTFDLFTAYNPGYFVVDIMASDLVGHNDTAIVGIYILRDDQRVKIIINEIPDKVRQFEE
EFISLLSNITGAIVNTDDVQFHVDKKGRVNFAQTELLIHVVNRETNRILDVERVIQMIDE
NKEQLRNLFRNYNVLDVQPAITARAPDDLSALQMAIIVLAVLLFLAAMLFILMNWYYRTV
HKRKLKAIVAGSTGNRGFMDIMDMPNTNKYSFDGANPVWLDPFCRNMELAAQAEHEDDLP
ENLSEITDLWNSPARTHGTFGREPSAAKPEDDRYLRAAIQEYDNIAKLGQIMREGPIKLI
QKELEDEEEERSPSQGSLRFRHKQPVELKGPDGIHVVHGSTGTLLASDLNSLPEDDQKVL
GRSLETLTADCGAYSDHNARTESAKSTPLHKMREVIMESPLEITEL
Download sequence
Identical sequences H0Z1B9
ENSTGUP00000004357 ENSTGUP00000004357 59729.ENSTGUP00000004357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]