SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004362 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004362
Domain Number 1 Region: 559-624
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.85e-17
Family Complement control module/SCR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 430-496
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000121
Family Complement control module/SCR domain 0.005
Further Details:      
 
Domain Number 3 Region: 183-246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000157
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 502-562
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000126
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 5 Region: 371-427
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000375
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 68-125
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000131
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 7 Region: 130-199
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000236
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Domain Number 8 Region: 3-70
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000127
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 9 Region: 249-304
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000115
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004362   Gene: ENSTGUG00000004241   Transcript: ENSTGUT00000004408
Sequence length 625
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:4394395:4401761:-1 gene:ENSTGUG00000004241 transcript:ENSTGUT00000004408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PCDLPQIENGNLAQYYYSFKRYYFPMHKGKKLSYSCMVGYTTESGTQDGRITCTAKGWSP
VPRCYRRCTKPLLENGSFYSTEMDFKIHEKLQYQCNPGYHTPSGATEDTVQCQPQGWSFQ
PSCIKKLESCQVPRLEHGSYSGAAQEVRLNGTLRYRCQHGYRSAAGSASDTALCLAHGWE
LPPSCTRITCSTLSEVAHGGFYPVKKTYEEGDVVHFFCDKYYSVTGFDLIQCYNFGWYPD
PPVCEDIKNKCPPPPLHGHMDGYISTARKTYHNGDKVRVQCTLGRRGSEEIQCEGGKWTS
PSTCIGTVDKQESGTAPPPLEADAEIRASQTHHNEDMSIHLCMWGNKMHVCNSESQVSNC
LSLYPISEMQQDCASPPVIKNGAVLGPLLESYKNGSWVEYGCQHYHFLDGPSTVYCDHGN
WTEQPTCLEPCTLNVTDMDSNNLTLKWRREELVFLHGDLIEFECKQGYSFLQTAIPSPGR
TQCDHGRLNYPKCVIQAATEKCGSPPSIANGVLTLPALPQYDSGSSVQYICSDYHFLQGS
DRISCSQGQWTSPPVCIEPCTLSKTEMEKNNVLLQAFYADQDYFYHGDYVGFYCKQNHFG
AESGTTLFQVQCKRGQLAYPRCVER
Download sequence
Identical sequences H0Z1C4
59729.ENSTGUP00000004362 ENSTGUP00000004362 ENSTGUP00000004362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]