SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004439 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004439
Domain Number 1 Region: 446-643
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-31
Family Laminin G-like module 0.0024
Further Details:      
 
Domain Number 2 Region: 661-839
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.1e-25
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 3 Region: 884-1085
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-24
Family Laminin G-like module 0.0072
Further Details:      
 
Domain Number 4 Region: 74-206
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 1271-1310
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000931
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 6 Region: 201-242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000017
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 7 Region: 1113-1156
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000343
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 8 Region: 1176-1307
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000283
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 280-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000103
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 353-459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000298
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 11 Region: 239-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000328
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 12 Region: 48-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family EGF-type module 0.012
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004439
Domain Number - Region: 898-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.013
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 3-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0194
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 859-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0203
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004439   Gene: ENSTGUG00000004300   Transcript: ENSTGUT00000004487
Sequence length 1380
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:4494806:4561818:1 gene:ENSTGUG00000004300 transcript:ENSTGUT00000004487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLCTRNDSRCLSNSCQKNSTCVAGHKDDPCLCADASVDSVEELCNKTSNPCSSNPCLQNA
TCLGSAGNLSFTCKCPAGYNGPSCETADSDCDTNPCEHGGTCQSGLAGPTCLCSAGYTGA
LCERDVDECISEPCRNGALCRDGVDEYSCYCVPGYQGKHCDLEVNECASEPCLNGATCLN
QIGHYVCICPLGYTGTNCEVEIDECLSQPCLNGGTCHDSLGSFSCSCARGFLGDRCGTDI
DECSSQPCLHGAPCMDGANGYSCNCTGTGFMGSHCETLIPLCWSQPCYNNATCEDHADNY
TCHCWPGYAGSRCEEDIAECRSSPCLSGGHCVERSWAGLYGLVPGLPPPFRYDRAEGYVC
RCPPGFAGTHCDEDVNECYTNPCQNGGICENFPGNYTCHCPPADKEGIFYGGWNCTEVLH
GCTDHQCQNNGICIPHLKNGQHGFSCICPPGYTGIHCETITTFSFQGNSFLLLKNSQTHK
KEFFNINLRFQTVQPTAFLFHRGEKNTFAKLELLNGYLHLSVQVNNQPQALLHIPHNVSD
GEWHSVEVTLARAVILNLLDSSCVESCLNKTSAKIDNEPVMFAFQSTYLGGLPVGNSNPL
QNTFNTHSAPSFVGCLQDVEIDLNVITPENVSSGSSLNVRTGCAKKDWCDPHPCQNRGRC
INLWLSYHCDCYRPYTGPDCAAEYIPGRFGSEDSSGYAAFPVGSTQNENFIISMFVRTRK
PSGLLLALRNSTYLYIRVYLEGGKLTMLALNSMKLLGKHSVNDGNFYLITLKIEPNKMEL
FQSSHYLGFISTPALTIQNKDTLYIGGLPDSKETDRNGRYFKGCIQDVRVNNQPLEFFPI
TNPPNSLINRTLINVTQGCTGDNLCKSSPCHNGGVCYSIWDDFTCTCPPNTVGKACEEVK
WCELGPCPHEAQCKLVHQGFECLANAVFSGRSSAIFYRSNGKISRDLTNIVFGFRTRDTD
VILLYAEREPEFVIISIHNSKLLFQLQSGNSFYRLTLASSVPVSDGKWHRVMVSMVEPLS
QSSRWYMDIDSKRDTSTSTAAAGSLNFLREETDIYVADKAFDSLDGLRGCMSTIEISGIY
LSYFENADIPTKKPQEEQFLKISANPALTGCLEVDFCSSDPCMHGGICEDFYTSYRCVCP
VGWTGTYCEVNIDECSSNPCIHGNCTDGIASYECSCEPGYTGENCEEDIDDCHGHQCVNG
ATCVDGINGYSCLCAANFTGRFCRYRRLPYTVCGNEERNLTCFNYGNCTDLGGELSCTCL
PGFVGERCEKDIDECSSDPCLNGGLCQNLLNKFHCLCDVNFAGDRCEIDLAAELMSSAFA
AVGAVTLALLALLALAVALSAVTASKRATQGTYSPSRQEKEGSRVEMWNMVQPPPMERLI
Download sequence
Identical sequences H0Z1J9
59729.ENSTGUP00000004439 ENSTGUP00000004439 ENSTGUP00000004439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]