SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004461 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004461
Domain Number 1 Region: 13-173
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.06e-38
Family MAM domain 0.000000491
Further Details:      
 
Domain Number 2 Region: 372-504
Classification Level Classification E-value
Superfamily Fibronectin type III 1.22e-16
Family Fibronectin type III 0.002
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004461
Domain Number - Region: 176-206
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0152
Family I set domains 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004461   Gene: ENSTGUG00000004328   Transcript: ENSTGUT00000004509
Sequence length 504
Comment pep:novel chromosome:taeGut3.2.4:20:3597264:3814481:1 gene:ENSTGUG00000004328 transcript:ENSTGUT00000004509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGVLLTGTAETFLGGCSFDEHYSNCGYSVALGTNGFTWEQINTWEKPTMDPAVPTGSFMM
VNSSGRASGQKAHLLLPTLKENDTHCIDFHYYLSSRDRSSPGSLNVYVKVNGGPQGNPIW
NVSGVVTEGWVKAELAISTFWPHFYQVIFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFL
RLQNVEVNVGQNATFQCIAGGKWSQHDKLWLQVKQCPAGSQKFLGTSEFIFLNSAPPLST
TARVGGASRLFVRAVLPVKYLNDCCVVLKDPDFSIASSTTQTCSNGPEYIFLVSLDYINQ
QDVSKHIQEEYKVTRGTRQHPVSLHSARLGFLGCVKHVEMKVLLQRIQAGITHQPGGAQS
NNNPKISNPVHGPQNVEVVDIRSRQLTLQWEPFGYAVTRCHSYNLTVHYQYVFNQQKFEA
EELIQTSSHYTLRGLRPFMTIRLRLALSNPEGKMESEELVVQTEEDVPGPVPLESIQGGP
FEEKIYVQWKPPNETNGIITLYEV
Download sequence
Identical sequences H0Z1M1
ENSTGUP00000004461 59729.ENSTGUP00000004461 ENSTGUP00000004461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]