SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004469 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004469
Domain Number 1 Region: 80-222
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.62e-39
Family Regulator of G-protein signaling, RGS 0.000000185
Further Details:      
 
Domain Number 2 Region: 764-804
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000062
Family DIX domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004469   Gene: ENSTGUG00000004338   Transcript: ENSTGUT00000004517
Sequence length 804
Comment pep:known_by_projection chromosome:taeGut3.2.4:14:2856011:2923965:-1 gene:ENSTGUG00000004338 transcript:ENSTGUT00000004517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTRKMNIQGKGFPLDLGGSFTEDAPRPPVPGEEGELVSTDPRPLSHGFYSGKSDVVRNET
STATPRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLD
FWFACSGFRKLEPCVSNEEKRLKLAKAIYKKYILDNNGIVSRQIKPATKSFIKDCVMKLQ
IDPDMFDQAQTEIQCMIEDNTYPLFLKSDIYLEYTRTGGESPKIYSDPSSGSGTGKGLPG
YLPTLNEDEEWKCDQEAEPEGSRDSAPSSRLTQKLLLETATQRAASARRYSEGREFRHGS
WREPVNPYYVNTGYALAPATSANDSEQQSMSSDADTMSLTDSSVDGIPPYRLRKQHRREM
QESAKANGRVPLPHIPRTYRMPKDIHVEPEKFAAELINRLEEVQKEREAEEKLEERLKRV
RAEEEGEDADISSGPSVMSHKMPSAQAFHHFAPRYAEMGCAGMQMRDAHEENPESILDEH
VQRVMKTPGCQSPGPGRHSPKPRSPESGHLGKLSGTLGTIPPGHGKHTAKSGMKLDAANL
YHHKHVYHHIHHHSMMKPKEQIEAEATQRVQNSFAWNVDSHNYATKSRNYSENLGMAPVP
MDSLGYSGKASLLSKRNVKKTDSGKSDGANYEMPGSPEDVEKNQKILQWIIEGEKEISRH
KKTNHGSSGAKKPQSHDVVRSLSIERPVAVHPWVSAQLRNVVQPSHPFIQDPTMPPNPAP
NPLTQLEEARRRLEEEEKRAGKLPLKQRLKPQKRPGGGAAQPCENIVVAYYFCGEPIPYR
TLVKGRVVTLGQFKELLTKKGNYR
Download sequence
Identical sequences H0Z1M9
59729.ENSTGUP00000004469 ENSTGUP00000004469 ENSTGUP00000004469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]