SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004629 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004629
Domain Number 1 Region: 3-236
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.85e-83
Family Eukaryotic proteases 0.0000749
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004629   Gene: ENSTGUG00000004490   Transcript: ENSTGUT00000004678
Sequence length 237
Comment pep:novel chromosome:taeGut3.2.4:4:25408671:25412302:1 gene:ENSTGUG00000004490 transcript:ENSTGUT00000004678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSLRIVGGLSSAETGDWPWQASLQYNNIHRCGATLISNTWLVSAAHCFRDMTHPEKWTAT
FGALLKPPSLKRSVKKIIIHENYLYPEHDYDIALVQLSKRVEFTSSIHHVCLPEPSQTFP
YNIYAVITGWGALTNDGPAPNALQEATVKLIDSETCNREEVYDGDITPRMLCAGYLEGGV
DACQGDSGGPLVTPDSRLMWYLVGIVSWGDECGKPNKPGVYTRVTYFRDWITTKTGI
Download sequence
Identical sequences H0Z239
ENSTGUP00000004629 59729.ENSTGUP00000004629 ENSTGUP00000004629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]