SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004699 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004699
Domain Number 1 Region: 8-334
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.07e-102
Family Glycosyl hydrolases family 35 catalytic domain 0.0000887
Further Details:      
 
Domain Number 2 Region: 453-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.08e-35
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004699   Gene: ENSTGUG00000004528   Transcript: ENSTGUT00000004748
Sequence length 600
Comment pep:known_by_projection chromosome:taeGut3.2.4:2:63367420:63403725:1 gene:ENSTGUG00000004528 transcript:ENSTGUT00000004748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQNVPERSFGIDYDSNCFVKDGKPFRYISGSIHYSRVPPYYWKDRLLKMKMAGLDAIQTY
VPWNYHEPQMGTYDFFGGKDLQYFLQLANDTGLLVILRAGPYICAEWDMGGLPAWLLEKK
SIVLRSSDSDYLEAVERWMGVLLPKMRPYLYQNGGPIIMVQVENEYGSYFACDYNYLRFL
LKLFRLHLGDEVVLFTTDGASQFHLKCGALQGLYATVDFAPGANVTAAFLAQRSSEPKGP
LVNSEFYTGWLDHWGHHHSVVPAQTIAKTLNEILASGANVNLYMFIGGTNFAYWNGANMP
YMPQPTSYDYDAPLSEAGDLTEKYFALRKVIGMYKQLPEGLTPPTTPKFAYGKVRLQKAG
TVLEVLDGLSRSGPVRSTYPLTFVELKQYFGYVLYRTTLPKNCVEPTPLSSPLNGVHDRA
YVSVDGVPQGVLERDKSLKINITGQAGASLDILVENMGRVNFGRYNNDFKGLVSNLTLAQ
DVLVGWEIYPLDIDGAVNYDIIYLLHHPKRSAIKELSYEVPTFYTGTLSIPGGIPDLPQD
TYVNFPGWTKGQIWINGFNLGRYWPARGPQLTLYVPRNVLVASAPNNITVLELERSPCST
Download sequence
Identical sequences H0Z2A9
59729.ENSTGUP00000004699 ENSTGUP00000004699 ENSTGUP00000004699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]