SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004735 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004735
Domain Number 1 Region: 243-483
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.57e-54
Family Crotonase-like 0.0000000727
Further Details:      
 
Domain Number 2 Region: 1-61
Classification Level Classification E-value
Superfamily Chromo domain-like 8.25e-18
Family Chromo domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004735   Gene: ENSTGUG00000004589   Transcript: ENSTGUT00000004784
Sequence length 499
Comment pep:known_by_projection chromosome:taeGut3.2.4:11:2657905:2681120:-1 gene:ENSTGUG00000004589 transcript:ENSTGUT00000004784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQVERIVDKRKNKKGKWEYLIRWKGYGSNEDTWEPEHHLLHCEEFIDEFNRLHVTREKRS
RHGKQAPKLLRESRGSSVEKISHRPSESGKSKGSTHKRKRINPSHQKQKRGYAAKPGSAN
DRAAKTVTYRTTPSGLQIMPLKKPHNGLQNGDGNHEKDSRHFGNGSQQQNVDLTDHEGEQ
NLPSVLEVSNNSPVVNGIGSSLANGSLNLHSTVKRKLDGEKDYVFDKRLRYSVRQNESNC
RFRDIVVRKEDGFTHILLSSQTSENNALTPEIMKEVRRALCNASADDSKLLLLSAVGSVF
CSGLDYSYLIGRLSNDRRKESTRIAEAIRDFVKAFIQFKKPIVVAINGPALGLGASILPL
CDIVWASEKAWFQTPYATIRLTPAGCSSYTFPQILGVALANEMLFCGRKLTAQEACSRGL
VSQVFWPTTFSQEVMLRVKEMASCSAVVLEESKCLVRSFLKSGLEEVNEKECQMLKQLWS
SSKGLDSLFSYLQDKIYEV
Download sequence
Identical sequences H0Z2E4
59729.ENSTGUP00000004735 ENSTGUP00000004735 ENSTGUP00000004735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]