SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004787 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004787
Domain Number 1 Region: 128-208
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000122
Family Ras-binding domain, RBD 0.029
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004787
Domain Number - Region: 4-24
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0228
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004787   Gene: ENSTGUG00000004653   Transcript: ENSTGUT00000004836
Sequence length 256
Comment pep:known_by_projection chromosome:taeGut3.2.4:12:3741788:3744588:-1 gene:ENSTGUG00000004653 transcript:ENSTGUT00000004836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPDCSFTCHYRCRALVQLDCGGPPGAGDEDDGNEQMLEKDTNVDEPSEWEKAELDQAQV
EQRIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPATKRGPSLQAGRPHPQGV
KRRTSFYLPKGTVKHLHIFSHTRASEVIDALLRKFTVIDNPRKFTLFERSEKDEQVYLRK
LGDDEQPLRLRLLAGPSEKVLSFILKENETGEVNWDAFTLPELHNFLLILQREEEEHVRR
LRHRYARCRQKMQEAL
Download sequence
Identical sequences H0Z2J5
ENSTGUP00000004787 ENSTGUP00000004787 59729.ENSTGUP00000004787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]