SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004798 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004798
Domain Number 1 Region: 45-245
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.74e-20
Family Pentraxin (pentaxin) 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004798
Domain Number - Region: 566-828
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.054
Family Rhodopsin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004798   Gene: ENSTGUG00000004659   Transcript: ENSTGUT00000004847
Sequence length 878
Comment pep:known_by_projection chromosome:taeGut3.2.4:15:278415:395554:-1 gene:ENSTGUG00000004659 transcript:ENSTGUT00000004847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESLLSLLCCHYSLLILFQQKYQVYGNYSQLPKHPGFRVLASASHYWPLEDVDGIHEFRD
TNGDIIEGMVNKGIYVTEKKGVTFLFFGSYRNSCISNPEACGPEGVTFSFFWKTQDQQAK
LLPASGGRVISSGFKICSNEGEGSVEFYSRGNAMMKWKASFSPPGPYWTHVLFTWRSREG
LKVYVNGSLSTADPDGKVFYDYGDAGSELLGGTEGTARRSVSGAFDEFVIWERALSPREV
RQYFTAAVGVQVLLSSTLPWSLMTTTTDPVLPTDAYQPIIAALSRDRGSSPSPSSLLGHL
QDVSFSLPNSSLAEHTALSLAQAFLKAVEDFLLLSDWIDGPESPAVLSSLIHTIDTVMAH
LSRNLEGSSEENSLPLTLEGSSAVADYAVVKMHPQTLNVSHYRFPSRGQSYISIPSEAFH
GKAWITIVGLLYHNMHYFFNNINPVDTRIAEAAAYKGYMISASSFLISIKVEPLPQLSHN
LSGSPLITIQLTHRLTPRQYSQALNKSNRVHLYCAFLDYSNGTGVWSDEGCVRESGDLNY
SVCLCNHLTNFAILMQVVPLKLTREHQVALSSITYVGCALSIFCLTITLVTFAVLSSVST
IRNQRYHIHANLSCAVLLAQALLLASFQLSPATLPCKIFAILLHFFFLSAFAWMLVEGFH
LYSMVIKVFGSEESKHLYYYGIGWGCPLVICVISAMSSLDSYGESGNCWLSLENGAIWAF
VAPAMFVILVNIGILIAVTRVISRISADSYKVHGDANAFKLTAKAVAVLLPILGSSWIFG
ILAVNAHALVFQYIFAVFNSLQGFFMFLFHCLLNSEVRAAFKHKTKVWSLTSSSARNINV
KPFNSDIMTGNRPGTTPTKLNTWDKSTNSANRIDLSAV
Download sequence
Identical sequences H0Z2K6
ENSTGUP00000004798 ENSTGUP00000004798 59729.ENSTGUP00000004798 XP_012433389.1.42559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]