SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004846 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004846
Domain Number 1 Region: 86-231
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.68e-38
Family Glutathione S-transferase (GST), C-terminal domain 0.00000393
Further Details:      
 
Domain Number 2 Region: 15-82
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000296
Family Glutathione S-transferase (GST), N-terminal domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004846   Gene: ENSTGUG00000004696   Transcript: ENSTGUT00000004895
Sequence length 233
Comment pep:known_by_projection chromosome:taeGut3.2.4:1:15047:28310:1 gene:ENSTGUG00000004696 transcript:ENSTGUT00000004895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAIELFVKAGSDGESIGNCPFSQRLFMILWLKGVIFNVTTVDLKRTDVNLAPGTNPPFMT
FDGEVKTDVNMIEEFLEEKLAPPRYPRLAPKHPESNSAGNDVFAKFSAFIKNPRKDANEN
LEKSLLKALKKLDNYLNSPLPDEMDAYSTEEITASSRKFLDGDELTLADCNLLPKLHIIK
VVAKKYRNFHFPPEMTGISRYLKNAYARDEFTNTCPADQEIEYAYLDVAKRMK
Download sequence
Identical sequences H0Z2Q4
ENSTGUP00000004846 59729.ENSTGUP00000004846 ENSTGUP00000004846

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]