SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004851 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004851
Domain Number 1 Region: 215-361
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-40
Family Third domain of FERM 0.00013
Further Details:      
 
Domain Number 2 Region: 113-217
Classification Level Classification E-value
Superfamily Second domain of FERM 5.36e-38
Family Second domain of FERM 0.0000822
Further Details:      
 
Domain Number 3 Region: 29-111
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-23
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004851   Gene: ENSTGUG00000004689   Transcript: ENSTGUT00000004900
Sequence length 519
Comment pep:novel chromosome:taeGut3.2.4:7:6890435:6959825:-1 gene:ENSTGUG00000004689 transcript:ENSTGUT00000004900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTVQAFRVNKHDQGQVLLDVVFK
HLDLTERDYFGLQLADESTDNPRWLDPNKPIRKQLKRGSPHSLNFRVKFFVSDPNKLQEE
YTRYQYFLQIKQDILTGRLPCPYNTAALLASYAVQSELGDYNHSENLPGYLSEYSFIPSQ
PQDFEKEIAKLHQQHIGLSPAEAEFNYLNTARTLELYGVELHYARDQSNNEIMIGVMSGG
ILIFKNRVRINTFQWLKIVKISFKCKQFFIQLRKELHESRETLLGFNMVNYRACKNLWKA
CVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQSVQYGKERANKDRVFARSPS
KPLARKVMSGMDWEVVSRNSLSDDRLETQSLPSRSPPGTPNHRNSAFTQEGARLRPSSVG
HLVDHVVHTSPSEVFVNHRSPSSTQANSIILESSPSQETPIDGQPPALPPKQFKKNSWNQ
IHHSHSQQELDNHINETFDVPASPEKSTPNGGVPHDNLV
Download sequence
Identical sequences H0Z2Q9
ENSTGUP00000004851 59729.ENSTGUP00000004851 ENSTGUP00000004851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]