SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004853 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004853
Domain Number 1 Region: 329-432
Classification Level Classification E-value
Superfamily Cullin homology domain 0.000000000000602
Family Cullin homology domain 0.0054
Further Details:      
 
Domain Number 2 Region: 3-84
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000822
Family APC10-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004853   Gene: ENSTGUG00000004706   Transcript: ENSTGUT00000004902
Sequence length 447
Comment pep:novel chromosome:taeGut3.2.4:3:19767112:19772004:-1 gene:ENSTGUG00000004706 transcript:ENSTGUT00000004902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RELSMLVASEDSSYMPSRVVVLGGDSPATIRTELNAVTVLPSDSRVILLENMTRFWPIIQ
IRVKRCQQGGIDTRVRGIEVLGPKPTFWPIFKEQLCRRTFLSCTAQAHAWSQEICRDRGR
LLQLFGRLNRALRHEQGFANRFLPDNEAARALGRTFWEALVNPLVQSITSPDPDGVSPLG
WLLTEYLESVELPRRATGHRAAFASCVRRLTQLLVHVDPGAAPDPAVAGQLTLGRWEGKE
EQGGASQDCKSSGLWGISQCWRGVVQQQVQRFLEAAGQAPDLAERYCRLYRRLRGATEEL
FGQQAAFVLALGQGFAGALLQLSFLTALHVSEQFARYLDVQIQELRRAAGSTGPLERLQQ
FLEPFVVFSGLEFAHSFEHFYRHYLGDRLLTQGPSWLEEGIVEQIGLCFPSRFPQDMLSN
LAESEELQRQFCLFQLQEQDKRLLELD
Download sequence
Identical sequences H0Z2R1
ENSTGUP00000004853 59729.ENSTGUP00000004853 ENSTGUP00000004853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]