SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004879 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004879
Domain Number 1 Region: 126-243
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 2.36e-45
Family Neurotrophin 0.00000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004879   Gene: ENSTGUG00000004743   Transcript: ENSTGUT00000004928
Sequence length 246
Comment pep:known chromosome:taeGut3.2.4:5:1307882:1308622:-1 gene:ENSTGUG00000004743 transcript:ENSTGUT00000004928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTILFFTMVISYFTCMKAAPMKEASLRGQGSLAYPGLRTHGTIESINGPSASSRGLTSLA
DTFEHVIEELLDEEQDIQPSEGNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAAN
MSMRVRRHSDPARRGELSVCDSTSEWVTAAEKKTAVDMSGATVTVLEKVPVPKGQLKQYF
YETKCNPKGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRVGWRFIRIDTSCVCTL
TIKRGR
Download sequence
Identical sequences Q4JHT7
ENSTGUP00000004879 ENSTGUP00000004879 NP_001041720.1.42559 XP_012429191.1.42559 XP_012429192.1.42559 XP_021394729.1.53032 XP_021394730.1.53032 59729.ENSTGUP00000004879

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]