SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004890 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004890
Domain Number 1 Region: 200-265
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000886
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000234
Further Details:      
 
Domain Number 2 Region: 268-306
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000814
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004890
Domain Number - Region: 45-100
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0659
Family Chromo barrel domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004890   Gene: ENSTGUG00000004735   Transcript: ENSTGUT00000004939
Sequence length 575
Comment pep:known_by_projection chromosome:taeGut3.2.4:4A:14043684:14065613:-1 gene:ENSTGUG00000004735 transcript:ENSTGUT00000004939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QAFVKDVHEDSITVSFENNWQPERQIPFHDVRFPPPAGYNKDINESDEVEVYSRANEKEP
CCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKPATKDTFHKIKLAVPED
LRQMCAKESAHKDFKKAVGAFSVTYDSENHQLIILSINDVTTKRANMLIDMHFRSLRTKL
SLILRNEEASKQLESSRQLASRFHEQFVVREDLMGLAIGTHGANIQQARKVPGVTAIDLD
EDTCTFHIYGEDQDAVKKARSYLEFAEDVIQVPRNLVGKVIGKNGKLIQEIVDKSGVVRV
RIEAENDKNIPQEEVCFQLTYFFLLLIDYILPSDKITLCIKGIRLHAVVSVRIKISLGMV
PFVFVGTKDSITNATVLLDYHLNYLKEVDQLRLERLQIDEQLRQIGATSRPPPNRTDKDK
GYMTDDGPGLGRGSRPYRNRGHSRRGPGYASGTNSEASNASETESDHRDELSDWSAAPAE
EERDNYLRRGDGRRRGGGGRGQGGRGRGGFKGNDEQSRTDNRQRNSREAKGRTADGSLEN
TSSEGSRLRAGKERNPKKEKTDGADAQQPLVNGVP
Download sequence
Identical sequences H0Z2U8
ENSTGUP00000004890 59729.ENSTGUP00000004890 ENSTGUP00000004890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]