SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004903 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004903
Domain Number 1 Region: 185-385
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-51
Family DBL homology domain (DH-domain) 0.000000351
Further Details:      
 
Domain Number 2 Region: 1-219
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-39
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 
Domain Number 3 Region: 372-534
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-34
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 
Domain Number 4 Region: 664-760,802-828
Classification Level Classification E-value
Superfamily SH2 domain 2.98e-24
Family SH2 domain 0.00079
Further Details:      
 
Domain Number 5 Region: 578-660
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000315
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 6 Region: 769-817
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000228
Family SH3-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004903   Gene: ENSTGUG00000004635   Transcript: ENSTGUT00000004952
Sequence length 831
Comment pep:known_by_projection chromosome:taeGut3.2.4:8:6065659:6212619:1 gene:ENSTGUG00000004635 transcript:ENSTGUT00000004952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGQWLISCKVLPPNHRVTWDTAQVFDLAQTLRDGVLLCQLLNNLRSHSINLKEINLRPQM
SQFLCLKNIRTFLSACCEIFGMKKSELFEAFDLFDVRDFGKVIETLSKLSRTPIALGTGI
RPFPTEESVDDEDIYKALPDLIDETGVEEDEELYDCVYGEDEGGEVYEDLMKDEAAQQPK
CPENDIRSCCLAEIKQTEEKYTETLESIEKFFMVPLKRFLSASEFDTVFINIPDLVKIHR
NLTQDVNDSIVNKNDQNLYQIFINYKERLVIYGQYCSQVEIAISCLDNISKTKEDVKLKL
EECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDAMEKANLKLALDAMKDLAQ
YVNEVKRDNETLREIRQFQLSIENLNHSLLQYGRPQGDGEIRITTIDRRARQDRHIFLFD
LAVIVCKRRGDNYEMKEIIDLQKYKITNNPTTDKENKKWSYGFYLIHIQGENGLEVYCKT
KDLKKKWLEQFQMALSNIRPDYADTSFHEFKMHTFSRVTSCKVCQMLLRGTFYQGYLCSK
CGAGAHKECLGRLDNCGRANLVFAGSLYTRIIKRSSEVPNRHSECCLPKMQVIRNYNGIP
QPAAQDGPPLHIQIGDTIELIRGDAHSLFWQGRNLTTGELGFFPSDAVKPSPSGDKSEIK
MKLLFAGAMERLQAESELINRANSTYLVRHRTTESGEYAISIKYNNEVKHIKILTRDGFF
HIAENRKFKNLMELVEYYKHHSLREGFRSLDTTLQFPYKESENSVGQRMLSPKVIGIAIA
RYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEED
Download sequence
Identical sequences H0Z2W1
ENSTGUP00000004903 59729.ENSTGUP00000004903 ENSTGUP00000004903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]