SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000004907 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000004907
Domain Number 1 Region: 257-413,458-501
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-46
Family SPRY domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTGUP00000004907
Domain Number - Region: 26-74
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0115
Family PHD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000004907   Gene: ENSTGUG00000004741   Transcript: ENSTGUT00000004956
Sequence length 545
Comment pep:known_by_projection chromosome:taeGut3.2.4:22:2784936:2792494:1 gene:ENSTGUG00000004741 transcript:ENSTGUT00000004956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAAGDGAEAMDAQGGSGDEENTRQLGEIELQCGICTKWFTADTFGIDTTSCLPFMTNYSF
HCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYW
ECMTTRQRPGKMTWPNNIVKTMCKERDVFLVKEHPDPGSKDPEEDTPKFLLDQYDLANIG
PAYDNQKQNNAVSTSGSLNGNWGMAAGGSGKGRGAKRKQQDGGTTGTAKKTRSDPLFSAQ
RLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLL
ALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEISMDEMPPDTAARLGWSQP
LGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYISLPEDTETAKSLP
DTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQAPGSQIIFFKNGVSQGVAFKDIFEGVYF
PAISLYKGCTVSINFGPYFKYPPRDITYHPMSDMGWGAVVEHTLADVLYHVETEVDGRRS
PPWEP
Download sequence
Identical sequences H0Z2W5
ENSTGUP00000004907 59729.ENSTGUP00000004907 ENSTGUP00000004907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]