SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005001 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005001
Domain Number 1 Region: 11-150
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.97e-42
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00042
Further Details:      
 
Domain Number 2 Region: 143-336
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.83e-39
Family Laminin G-like module 0.0041
Further Details:      
 
Domain Number 3 Region: 324-493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.05e-36
Family Laminin G-like module 0.0038
Further Details:      
 
Domain Number 4 Region: 698-712,748-910
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.2e-35
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 5 Region: 941-1144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.94e-28
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 6 Region: 550-612
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.000000000942
Family Fibrinogen C-terminal domain-like 0.0037
Further Details:      
 
Domain Number 7 Region: 522-558
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000838
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005001   Gene: ENSTGUG00000004748   Transcript: ENSTGUT00000005051
Sequence length 1279
Comment pep:known_by_projection chromosome:taeGut3.2.4:7:7834568:8039714:1 gene:ENSTGUG00000004748 transcript:ENSTGUT00000005051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NCDDALVSPLPSAALTSSSELFSTHSPSFAKLNRRDGAGGWSPLESNEQQWLQVDLGDRV
EIVAVATQGRYGSSDWVSAYALTFSDTGRNWRQYRQDDAVWVFTGNSNADSVVHHKLLHS
MKARFLRFIPLKWNAGGRIGLRVEVFGCSYKSDIADFDGRSSLLYRFNQKLMSTFKDVVS
LKFKSMQGDGVLFHGEGQRGDYITLELQKGKLSLHLNLGDSNLHFSNSHTSVTLGSLLDD
QHWHSVLIERFNKQVNFTVDKHTQHFRTKGDSDHLDIDYELSFGGIPVPGKPGTFQRKNF
HGCIENLYYNGVNIIDLAKRRKPQIYTGNVTFSCSEPQIVPITFVSTSRSYLLLPGTAQI
DGLSVSFQFRTWNKDGLLLFTELSENSGHLLVYLRGGRLMLLIQKETENPVEISEGTNLH
DGLWHSVNINARRHRITLTLDNDAATASHATTVSRMYSGNTYYFGGCPDNFTDSQCLNPI
TGFQGCMRLIFIDNQPKDLILVQQGSLGNFSDLHIDLCGIKDRCLPNYCEHGGKCSQSWS
TFYCDCNNTGYMGATCHNSVYEQSCEAYRHQGKTSGLFYIDSDGSGPLGPLRVFCNITED
KIWTEVQHNSTGLTRVQGAGPGKPYTMSFNYSSSAEQLEAVINSAEYCEQEAAYHCRKSR
LLNTPNGVPFAWWVGRANEKHLYWGGSLPGIQQCACGLEESCLDMRYFCNCDADREEWTN
DTGLLAFKDHLPVTQIVITDTNRSNSEAAWKIGPLRCYGDRQFWNAASFNTEASYLHFPT
LHAEVSADISFFFKTTAVSGVFLENLGIKDFIRIEISSPKEITFSIDVGNGPTEATVQSP
TALNDNQWHYVRAERNLKETSLQVDNLPKKVLEAPAEGHFRLQLNSQLFVGGAASRRKGF
LGCIRSLHLNGQKLDLEGRTKMTPGVKPGCPGHCSSYGNLCHNGGKCVEKYNGYFCDCTN
SAYEGPFCKEEVSALFEAGTSVTYTFQEPYPVTKNASTSSSAIYVDAVMSKENIAFSFLT
AHTPSLLLYINTYFHEYLAVILSKNGNLQVRYKLSKDGLLIFTIDSGNFANRELHHVKIN
REGRELVIQVDQVLKLKHNFSEIDFKAIKSLTLGKVTDSLSLDPEVSKANAYGFTGCLSS
VQYNHISPLKAALRHPSIAPVTVRGSLTESSCASMMEADVNTATTIYSSSDPFGKTDERE
PLTNAVRSDSAVIGGVIAVVIFIIFCIIAIMSRFLYQHKQAHRNSQKKEKEYPENLESSF
KADIDLQNTVSECKREYFI
Download sequence
Identical sequences H0Z359
59729.ENSTGUP00000005001 ENSTGUP00000005001 ENSTGUP00000005001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]