SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTGUP00000005006 from Taeniopygia guttata 76_3.2.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTGUP00000005006
Domain Number 1 Region: 219-328
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 9.03e-35
Family Transforming growth factor (TGF)-beta 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTGUP00000005006   Gene: ENSTGUG00000004869   Transcript: ENSTGUT00000005056
Sequence length 328
Comment pep:known_by_projection chromosome:taeGut3.2.4:4A:15596686:15598225:-1 gene:ENSTGUG00000004869 transcript:ENSTGUT00000005056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTLPLLQALQTRAPGGPGWQVRPASGQPLRYMLNLYRRAADPEGRPRRSRSLGTNTVRLV
QATSHGGQPWAGRRYLQALTYHVESQPEVEHLLRATVVYLPSLSMAHGRLLCTLELVTAD
EAPRVLSPTARPRRGWAEVDVTPYLVLGNSSVGSLALQHVGVRAGRAGGHNASVAPGHPF
LLLYLNDTQAGLAPPSAEPRRRRRDTGTLAHDLPSYLREQGGEKSDCSLHSFPVSFAQLG
WDHWIIAPHRYNPRYCKGTCPHLLRYDYHAPNHAVVQSFVHQLVDANVPRPSCVPYRYSP
ISVLMIERNGGILYKEFENMIAESCTCR
Download sequence
Identical sequences H0Z363
ENSTGUP00000005006 ENSTGUP00000005006 59729.ENSTGUP00000005006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]